DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3842 and CG2064

DIOPT Version :9

Sequence 1:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster


Alignment Length:333 Identity:177/333 - (53%)
Similarity:222/333 - (66%) Gaps:26/333 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 IFLIVLGILLFMW---------LLRKCIQGPAYRKANRIDGKVVIVTGCNTGIGKETVLELAKRG 98
            ||:..|...|.||         .|::.:||..:.|.....|||.||||.||||||||.||:|:||
  Fly     3 IFIDCLLSPLIMWPATIGVGIYFLKEYMQGGKFTKDTDETGKVFIVTGANTGIGKETALEIARRG 67

  Fly    99 ARVYMACRDPGRCEAARLDIMDRSRNQQLFNRTLDLGSLQSVRNFVERFKAEESRLDILINNAGV 163
            ..||:||||..|||.||.||:..:.||.:|:|.|||.||.|:|.||:.||.|:.:|.:|||||||
  Fly    68 GTVYLACRDMNRCEKARKDIIKETNNQNIFSRELDLSSLDSIRKFVDGFKKEQPKLHVLINNAGV 132

  Fly   164 MACPRTLTADGFEQQFGVNHLGHFLLTNLLLDRLKHSSPSRIVVVSSAAHLFGRINREDLMSEKN 228
            |.||:|||.||:|.|.||||:|||||||||||.||:|:|||||||||.||..|.||..||.|||:
  Fly   133 MRCPKTLTKDGYELQLGVNHIGHFLLTNLLLDVLKNSAPSRIVVVSSLAHARGSINVADLNSEKS 197

  Fly   229 YSKFFGAYSQSKLANILFTLKLSTILKDTGVTVNCCHPGVVRTEINRHFSGPGWMKTALQKGSLY 293
            |.:.. |||||||||:|||.:|:..|:.:|||||..|||||.||:.|:::   :.:|.|.|    
  Fly   198 YDEGL-AYSQSKLANVLFTRELAKRLEGSGVTVNALHPGVVDTELARNWA---FFQTNLVK---- 254

  Fly   294 FF---------KTPKAGAQTQLRLALDPQLEGSTGGYYSDCMRWPLFPWVRNMQTADWLWRESEK 349
            ||         ||||:||||.:..||||:|:..:|.|:|||...|:.....:.:.|.:||.||||
  Fly   255 FFLKPMIWPLLKTPKSGAQTSIYAALDPELKNISGLYFSDCKPKPVASGALDDKVAKFLWAESEK 319

  Fly   350 LLGLPPLE 357
            ..||..||
  Fly   320 WTGLDKLE 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3842NP_001259270.1 FabG 71..319 CDD:223959 150/256 (59%)
NADB_Rossmann 74..347 CDD:304358 159/281 (57%)
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 163/289 (56%)
NADB_Rossmann 43..317 CDD:304358 159/281 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448977
Domainoid 1 1.000 171 1.000 Domainoid score I1148
eggNOG 1 0.900 - - E2759_KOG1208
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 219 1.000 Inparanoid score I1212
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 1 1.000 - - mtm6476
orthoMCL 1 0.900 - - OOG6_100091
Panther 1 1.100 - - P PTHR24320
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1905
SonicParanoid 1 1.000 - - X72
1211.830

Return to query results.
Submit another query.