DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3842 and CG9265

DIOPT Version :9

Sequence 1:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster


Alignment Length:293 Identity:61/293 - (20%)
Similarity:109/293 - (37%) Gaps:89/293 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 VVIVTGCNTGIGKETVLELAKRGARVYM-ACRDPGRCEAARL----------DIMDRSRNQQLFN 129
            :.::||...|:|:.....|.|.|.:|.: .....|..|..::          .::|.|:.:::: 
  Fly    88 IALITGGGNGLGRLLAERLGKMGTKVVIWDINKKGIAETVQIVEEAGGYCKGYVVDISKKEEVY- 151

  Fly   130 RTLDLGSLQSVRNFVERFKAEESRLDILINNAGVMACPRTL-TADG-FEQQFGVNHLGHFLLTNL 192
            :..|:            .:.|...:.:|||||||::....| |.|. .|:.|.||.:.||..|..
  Fly   152 KAADV------------IRDEVGDITLLINNAGVVSGLHLLDTPDHLIERSFNVNVMAHFWTTKA 204

  Fly   193 LLDRLKHSSPSRIVVVSSAAHLFGRINREDLMSEKNYSKFFGAYSQSKLANILF--TLKLS-TIL 254
            .|.::..:....|..::|.|   |.:....|:.          |..||.|.:.|  .|:|. .:|
  Fly   205 FLPKMIENDRGHIATIASLA---GHVGISKLVD----------YCASKFAAVGFDEALRLELEVL 256

  Fly   255 KDTGVTVNCCHPGVVRT-----EINRHFSGPGWMKT------------ALQKGSLYFFKTPKAGA 302
            ..|.:...|..|..::.     ::|..     |:.|            |::|..           
  Fly   257 GHTNIRTTCICPFFIQATGMFDDVNAR-----WVPTLNPNDVADRVIAAIRKNE----------- 305

  Fly   303 QTQLRLALDPQLEGSTGGYYSDCM--RWPLFPW 333
                :||:.|       |:....:  :| .|||
  Fly   306 ----KLAVIP-------GFLKVLLSFKW-TFPW 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3842NP_001259270.1 FabG 71..319 CDD:223959 56/275 (20%)
NADB_Rossmann 74..347 CDD:304358 61/293 (21%)
CG9265NP_001260655.1 fabG 82..299 CDD:235546 51/241 (21%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 61/293 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447621
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.