DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3842 and CG13284

DIOPT Version :9

Sequence 1:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001260523.1 Gene:CG13284 / 35021 FlyBaseID:FBgn0032614 Length:339 Species:Drosophila melanogaster


Alignment Length:365 Identity:80/365 - (21%)
Similarity:136/365 - (37%) Gaps:75/365 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PTAESVEKTLCFRGF-W----AWAVLIFLIVLGILLF-----MWLLRKCIQGPAYR---KANRID 73
            |..|....||....| |    |...|:.|:.:|:.|:     :..:.|.:..|.::   ....:|
  Fly     3 PVLEVSIYTLLKMAFIWQLISAAIYLVGLLTIGVFLYDNLKSLVSIIKAVLEPYFQPHLPRTLVD 67

  Fly    74 --GKVVIVTGCNTGIGKETVLELAKRGARVYMACRDPGRCEAARLDIMDRSRNQQLFNRTLDLGS 136
              |:..:|||...|||||...|||::|..:.:..|...:..|...:|    .:|...........
  Fly    68 KFGQWAVVTGATDGIGKEYARELARQGINLVLISRTKEKLIAVTNEI----ESQYKVKTKWIAAD 128

  Fly   137 LQSVRNFVERFKAEESRLD--ILINNAGVM-ACPRTL---TADGFEQQFGVNHLGHFLLTNLLLD 195
            ....|...::.:.|.:.:|  ||:||.|:| ..|.:|   :.|.......||.....:||..:|.
  Fly   129 FAKGREVYDQIEKELAGIDVGILVNNVGMMYEHPESLDLVSEDLLWNLLTVNMGSVTMLTRKILP 193

  Fly   196 RLKHSSPSRIVVVSSAAHLFGRINREDLMSEKNYSKFFGAYSQSKLANILFTLKLSTILKDTGVT 260
            ::.......||.:.|::.|....|             ...|:.||.....|:..|...:.:..:.
  Fly   194 QMIGRRKGAIVNLGSSSELQPLPN-------------MTVYAASKKFVTYFSKALELEVAEHNIH 245

  Fly   261 VNCCHPGVVRTEINRHFSGPGWMKTALQKGSLYFFKTPKAGAQTQLRLALDPQLEGS-TGGYYSD 324
            |....|..|.|::|.:       ...:.:|.|:|     ..|.|..|.|:....:.| |.|:   
  Fly   246 VQLVMPNFVVTKMNAY-------TDRVMQGGLFF-----PNAYTFARSAVFTLGKTSETNGF--- 295

  Fly   325 CMRWPLFPWVRNMQTADWLWRESEKLLGLPPLEPPPPVQS 364
                    |...:|.|         ::.|.||    |:::
  Fly   296 --------WTHGIQYA---------IMKLAPL----PIRT 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3842NP_001259270.1 FabG 71..319 CDD:223959 58/256 (23%)
NADB_Rossmann 74..347 CDD:304358 62/279 (22%)
CG13284NP_001260523.1 DltE 70..323 CDD:223377 66/298 (22%)
17beta-HSD1_like_SDR_c 70..309 CDD:187614 63/287 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447697
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.