DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3842 and firl

DIOPT Version :9

Sequence 1:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001033900.2 Gene:firl / 34627 FlyBaseID:FBgn0032405 Length:318 Species:Drosophila melanogaster


Alignment Length:242 Identity:56/242 - (23%)
Similarity:102/242 - (42%) Gaps:33/242 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FLIVLGILLFMWLLRKCIQGPAYRKANRIDGKVVIVTGCNTGIGKETVLELAKRGARVYMACRD- 107
            |.:.:.|||.:::  ..:|....:|...:.|::|::||...|||:|..|..|..|:.|  .|.| 
  Fly    27 FELYVRILLELFV--SLVQIVLPKKQKDVSGEIVLITGTGHGIGRELALHYASLGSTV--VCVDI 87

  Fly   108 PGRCEAARLDIMDRSRNQQLFNRTLDLGSLQSVRNFVERFKAEESRLDILINNAGVMACPRTL-- 170
            .|:.....::...|....::::.:.|:.....|....:|.|::...:.:|:||.|:|.....|  
  Fly    88 DGKNNLQTVEKAKRLNLGEVYSYSCDVSKRDEVTALADRIKSDVGCISVLVNNVGIMPTHPILQQ 152

  Fly   171 TADGFEQQFGVNHLGHFLLTNLLLDRLKHSSPSRIVVVSSAAHLFGRIN--------------RE 221
            :|:..::.|.||....|......|..::......|:.:||.|.|.|..|              .|
  Fly   153 SAEEIQRVFDVNVFSQFWTIQAFLPHMQEKCRGHIICMSSIAGLVGISNLVPYCATKFAVRGLME 217

  Fly   222 DLMSEKNYSKFFGAYSQSKLANILFTLKLSTILKDTGVTVNCCHPGV 268
            .|.:|         ..|....:::.|..:...:.:||:   |.||.|
  Fly   218 ALHAE---------LRQGPFRDLIRTTTIFPYMTNTGL---CKHPKV 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3842NP_001259270.1 FabG 71..319 CDD:223959 50/215 (23%)
NADB_Rossmann 74..347 CDD:304358 50/212 (24%)
firlNP_001033900.2 adh_short 56..246 CDD:278532 44/200 (22%)
17beta-HSDXI-like_SDR_c 57..299 CDD:187598 49/210 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447655
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.