DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3842 and CG15629

DIOPT Version :9

Sequence 1:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_608859.1 Gene:CG15629 / 33679 FlyBaseID:FBgn0031630 Length:325 Species:Drosophila melanogaster


Alignment Length:269 Identity:63/269 - (23%)
Similarity:104/269 - (38%) Gaps:73/269 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VLIFLI-----VLGILLFMWLLRKCIQGPAYRKANRIDGKVVIVTGCNTGIGKETVLELAKRGAR 100
            :|:|.|     ||..:.:..|.::      :||...|.|:||::||...|:|:...|..|:..||
  Fly    24 LLVFTIKSVYYVLESIYYSLLPQR------FRKLKDISGQVVLITGGGGGVGRLIALNFARLQAR 82

  Fly   101 V---------------YMACRDPGRCEAARLDIMDRSRNQQLFNRTLDLGSLQSVRNFVERFKAE 150
            :               .:|......|:...:||.||   :|::.|             ..:...|
  Fly    83 IVIWDINQEAIKTTVDLLAKHGYDNCKGYVVDISDR---EQIYQR-------------ASQVTEE 131

  Fly   151 ESRLDILINNAGVMAC-------PRTLTADGFEQQFGVNHLGHFLLTNLLLDRLKHSSPSRIVVV 208
            ...:||||||||::.|       .|.:     :..:.:|.:.|:......|..:..::...||.|
  Fly   132 VGPVDILINNAGIVCCKPFWELHDRVI-----QNTYNINIISHYWTVKAFLPHMMRNNRGHIVTV 191

  Fly   209 SSAAHLFGRINREDLMSEKNYSKFFGAYSQSKLANILFTLKLSTILKDTG---VTVNCCHPGVVR 270
            .|...:.|.....|             |:.:|.|.|.|...|.|.||..|   :.::...|..:.
  Fly   192 GSVTGMLGTYGCSD-------------YAATKYACIGFHESLLTDLKAHGYDQIQMSLICPYYIN 243

  Fly   271 TEINRHFSG 279
            |.:   |||
  Fly   244 TGM---FSG 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3842NP_001259270.1 FabG 71..319 CDD:223959 55/234 (24%)
NADB_Rossmann 74..347 CDD:304358 54/231 (23%)
CG15629NP_608859.1 17beta-HSDXI-like_SDR_c 58..298 CDD:187598 53/229 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447586
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.