DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3842 and Mfe2

DIOPT Version :9

Sequence 1:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001285318.1 Gene:Mfe2 / 32582 FlyBaseID:FBgn0030731 Length:598 Species:Drosophila melanogaster


Alignment Length:252 Identity:69/252 - (27%)
Similarity:105/252 - (41%) Gaps:54/252 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 RIDGKVVIVTGCNTGIGKETVLELAKRGARVYM-----ACRDPGRCEAARLDIMDRSRNQ----- 125
            |.||:|.:|||...|:|:|..|..|:|||:|.:     .....|..:.|...::|..|..     
  Fly     9 RYDGRVAVVTGAGAGLGREYALLFAERGAKVVVNDLGGTHSGDGASQRAADIVVDEIRKAGGEAV 73

  Fly   126 QLFNRTLDLGSLQSVRNFVERFKAEESRLDILINNAGVMACPRTLTADGFEQQFG-VN--HL-GH 186
            ..:|..:|  ..:.:...::.|    .|:|||:||||::. .|:|.... ||.:. ||  || |.
  Fly    74 ADYNSVID--GAKVIETAIKAF----GRVDILVNNAGILR-DRSLVKTS-EQDWNLVNDVHLKGS 130

  Fly   187 FLLTNLLLDRLKHSSPSRIVVVSSAAHL---FGRIN----REDLMSEKNYSKFFGA--------- 235
            |..|......:|..:..||::.||.:.:   ||::|    :..|:...|.....||         
  Fly   131 FKCTQAAFPYMKKQNYGRIIMTSSNSGIYGNFGQVNYTAAKMGLIGLANTVAIEGARNNVLCNVI 195

  Fly   236 -------YSQSKLANILFT-LKLSTILKDTGVTVNCCHPGVVRTEINRHF--SGPGW 282
                   .::..|.:|||. ||...|   ..|....||..   .|.|..:  |..||
  Fly   196 VPTAASRMTEGILPDILFNELKPKLI---APVVAYLCHES---CEDNGSYIESAAGW 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3842NP_001259270.1 FabG 71..319 CDD:223959 69/252 (27%)
NADB_Rossmann 74..347 CDD:304358 67/249 (27%)
Mfe2NP_001285318.1 hydroxyacyl-CoA-like_DH_SDR_c-like 8..257 CDD:187611 69/252 (27%)
PRK07791 11..248 CDD:236099 68/250 (27%)
PLN02864 315..598 CDD:178455
hot_dog <383..442 CDD:294345
HDE_HSD 471..592 CDD:239532
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447674
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.