DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3842 and CG31809

DIOPT Version :9

Sequence 1:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster


Alignment Length:348 Identity:78/348 - (22%)
Similarity:132/348 - (37%) Gaps:94/348 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LIFLI-VLGILLFMW-------LLRKCIQGPAYRK------ANRIDGKVVIVTGCNTGIGKETVL 92
            ||::: .|.|..|::       .:.|.:..|.:|.      |.:. |...:|||...|||||...
  Fly     3 LIYIVGSLSIAAFLYENLKSLFSIIKSVVEPFFRPNLPKTLAEKF-GNWAVVTGATDGIGKEYAR 66

  Fly    93 ELAKRGARVYMACRDPGRCEAARLDIMDRSRNQQLFNRTLDLGSLQSVR------NFV---ERFK 148
            |||::|..:.:..|                :.::|...|.::||..:|:      :|.   |.:.
  Fly    67 ELARQGLNLVLVSR----------------KEEKLIAVTNEIGSQYNVKIKWIVADFAKGREVYA 115

  Fly   149 AEESRLD-----ILINNAGVMACPRTL---TADGFEQQFGVNHLGHFLLTNLLLDRLKHSSPSRI 205
            ..|..|:     ||:||.|.:..|.:|   :.|.......||.....:||..:|.::.......|
  Fly   116 HIEKELNGIEVGILVNNVGTIHDPESLDKVSEDMLWDLLTVNVGSVTMLTRKILPQMISRRKGAI 180

  Fly   206 VVVSSAAHLFGRINREDLMSEKNYSKFFGAYSQSKLANILFTLKLSTILKDTGVTVNCCHPGVVR 270
            |.:.|::         :|....|.:    ||:.:|.....||..|...:.:..:.|....|..|.
  Fly   181 VNLGSSS---------ELQPHPNLT----AYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVA 232

  Fly   271 TEINRHFSGPGWMKTALQKGSLYFFKTPKAGAQTQLRLALDPQLEGS-TGGYYSDCMRWPLFPWV 334
            |.:|.:       ...:::|.|.|     ..|.:..|.|:....:.| |.|:           ||
  Fly   233 TNMNSY-------SDKVRQGGLLF-----PNAYSYARSAVFTLGKTSETNGF-----------WV 274

  Fly   335 RNMQTADWLWRESEKLLGLPPLE 357
            ..:|.|         |:.|.|:|
  Fly   275 HGLQYA---------LMKLFPME 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3842NP_001259270.1 FabG 71..319 CDD:223959 59/265 (22%)
NADB_Rossmann 74..347 CDD:304358 65/290 (22%)
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 67/298 (22%)
DltE 50..302 CDD:223377 68/300 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447691
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.