DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3842 and Rdh12

DIOPT Version :9

Sequence 1:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001101507.1 Gene:Rdh12 / 314264 RGDID:1310462 Length:316 Species:Rattus norvegicus


Alignment Length:318 Identity:159/318 - (50%)
Similarity:205/318 - (64%) Gaps:10/318 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VLIFLIVL-GILLFMWL----LRKCIQGPAYRKANRIDGKVVIVTGCNTGIGKETVLELAKRGAR 100
            :|:.|::| .....::|    :||...|.......:|.||||::||.||||||||..|||:||||
  Rat     1 MLVILVLLTSFFSILYLATPSIRKFFAGGVCTTKVQIPGKVVVITGANTGIGKETARELARRGAR 65

  Fly   101 VYMACRDPGRCEAARLDIMDRSRNQQLFNRTLDLGSLQSVRNFVERFKAEESRLDILINNAGVMA 165
            ||:||||..:.|:|..:|...::|.|:..|.|||...:|:|.|.|.|.|||.:|.|||||||||.
  Rat    66 VYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRTFAEGFLAEEKKLHILINNAGVMM 130

  Fly   166 CPRTLTADGFEQQFGVNHLGHFLLTNLLLDRLKHSSPSRIVVVSSAAHLFGRINREDLMSEKNYS 230
            ||.:.|.||||..||||||||||||.|||.|||.|:|:|::.:||.|||.|:|...||.|:|.|.
  Rat   131 CPYSKTVDGFETHFGVNHLGHFLLTYLLLGRLKESAPARVINLSSVAHLGGKIRFHDLQSKKRYC 195

  Fly   231 KFFGAYSQSKLANILFTLKLSTILKDTGVTVNCCHPGVVRTEINRHFSGPGWMKTALQKGSLYFF 295
            ..| |||.|||||:|||.:|:..|:.||||....|||.|.:||.||    .::...|.:....||
  Rat   196 SGF-AYSHSKLANVLFTRELAKRLQGTGVTAYVVHPGCVLSEITRH----SFLMCLLWRLFSPFF 255

  Fly   296 KTPKAGAQTQLRLALDPQLEGSTGGYYSDCMRWPLFPWVRNMQTADWLWRESEKLLGL 353
            |:|..||||.|..||:..||..:|.|:|||.|..:.|..||.:||:.||..|.:|||:
  Rat   256 KSPWQGAQTSLHCALEEGLEPLSGKYFSDCKRTWVSPRARNKKTAERLWNVSCELLGI 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3842NP_001259270.1 FabG 71..319 CDD:223959 135/247 (55%)
NADB_Rossmann 74..347 CDD:304358 147/272 (54%)
Rdh12NP_001101507.1 NADB_Rossmann 39..307 CDD:419666 147/272 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 1 1.100 - - O PTHR24320
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.