DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3842 and Cbr3

DIOPT Version :9

Sequence 1:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001100580.1 Gene:Cbr3 / 304078 RGDID:1309728 Length:277 Species:Rattus norvegicus


Alignment Length:279 Identity:77/279 - (27%)
Similarity:113/279 - (40%) Gaps:67/279 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 KVVIVTGCNTGIGKETVLELAKR-GARVYMACRDPGRCEAARLDIMDRSRNQQLFNRTLDLGSLQ 138
            :|.:|||.|.|||.....:|.:: ...|.:..||..|..||...:.....:.:.  ..||:.:.|
  Rat     6 RVALVTGANKGIGFAITRDLCRKFSGDVVLTARDEARGRAAVKQLQAEGLSPRF--HQLDIDNPQ 68

  Fly   139 SVRNFVERFKAEESRLDILINNAGV---MACPRTLTADGFEQQFGVNHLGHFLLT-NLLLDRLKH 199
            |:|...:..:.|...|::|:||||:   |..|..     |:.|..|....:|..| |:..:.|..
  Rat    69 SIRALRDFLRKEYGGLNVLVNNAGIAFRMDDPTP-----FDVQAEVTLKTNFFATRNVCTELLPI 128

  Fly   200 SSP-SRIVVVSSAAHLFGRIN---------REDLMSEKN----YSKFF---------------GA 235
            ..| .|:|.|||...|....|         |.|.::|.:    ..||.               .|
  Rat   129 MKPHGRVVNVSSLQGLKALENCSEDLQERFRCDTLTEGDLVDLMKKFVEDTKNEVHEREGWPDSA 193

  Fly   236 YSQSKLANILFTLKLSTIL----KDTGVTVN-CCHPGVVRTEINRHFSGPGWMKT--ALQKGSLY 293
            |..|||...:.|..|:..|    |...:.:| ||               |||:||  |..:||  
  Rat   194 YGVSKLGVTVLTRILARQLDEKRKADRILLNACC---------------PGWVKTDMARDQGS-- 241

  Fly   294 FFKTPKAGAQTQLRLALDP 312
              :|.:.||:|.:.|||.|
  Rat   242 --RTVEEGAETPVYLALLP 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3842NP_001259270.1 FabG 71..319 CDD:223959 77/279 (28%)
NADB_Rossmann 74..347 CDD:304358 77/279 (28%)
Cbr3NP_001100580.1 carb_red_PTCR-like_SDR_c 6..277 CDD:187585 77/279 (28%)
adh_short 6..241 CDD:278532 67/256 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.