DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3842 and Dhrs13

DIOPT Version :9

Sequence 1:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_038943561.1 Gene:Dhrs13 / 303275 RGDID:1305508 Length:375 Species:Rattus norvegicus


Alignment Length:359 Identity:141/359 - (39%)
Similarity:202/359 - (56%) Gaps:13/359 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LIVLGILLFMWLL--RKCIQGPAYRKANRIDGKVVIVTGCNTGIGKETVLELAKRGARVYMACRD 107
            |:..|:||..::|  ...::.|.......:.|:..:|||.|:||||.|.||||:|||||.:|||.
  Rat     5 LLGAGLLLGAYVLVYYNLVKAPPCGGIGSLRGRTAVVTGANSGIGKMTALELARRGARVVLACRS 69

  Fly   108 PGRCEAARLDIMDRSRNQQLFNRTLDLGSLQSVRNFVERFKAEESRLDILINNAGVMACPRTLTA 172
            ..|.|||..|:...|.|.::....|||.||.||:.|...|.:.|.||||||:|||:.:|.|  |.
  Rat    70 RERGEAAAFDLRQESGNNEVIFMALDLASLTSVQAFATAFLSSEPRLDILIHNAGISSCGR--TR 132

  Fly   173 DGFEQQFGVNHLGHFLLTNLLLDRLKHSSPSRIVVVSSAAHLFGRINREDL-MSEKNYSKFFGAY 236
            :.|.....|||:|.||||:|||.||:..:|||:|:||||||..||::...| .....:.:...||
  Rat   133 ETFNLLLRVNHVGPFLLTHLLLPRLRSCAPSRVVIVSSAAHRRGRLDFTRLDCPVVGWQQELRAY 197

  Fly   237 SQSKLANILFTLKLSTILKDTGVTVNCCHPGVVRTEI-NRHFSGPGWMKTALQKGSLYFFKTPKA 300
            :.|||||:||..:|:|.|:.||||....|||.|.:|: .||.  |||::..|:..:....:.|:.
  Rat   198 ADSKLANVLFARELATQLEGTGVTCYAAHPGPVNSELFLRHL--PGWLRPILRPLAWLVLRAPQG 260

  Fly   301 GAQTQLRLALDPQLEGSTGGYYSDCMRWPLFPWVRNMQTADWLWRESEKLLGLPPLEPPPPVQSP 365
            ||||.|..||...:|..:|.|:::|....:....|:.|.|..||:.::||.||.|.:.|     .
  Rat   261 GAQTPLYCALQEGIEPLSGRYFANCHVEEVSAAARDDQAAHRLWKVTKKLAGLGPEDDP-----D 320

  Fly   366 TQNGNGTQNGNGSSSASASASSNNPASREMQSVE 399
            |.:....::....||.||.:......|...:|.:
  Rat   321 TDDEQEPRDPRAPSSLSAPSPEKTTISGPSRSYQ 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3842NP_001259270.1 FabG 71..319 CDD:223959 114/249 (46%)
NADB_Rossmann 74..347 CDD:304358 122/274 (45%)
Dhrs13XP_038943561.1 retinol-DH_like_SDR_c_like 36..304 CDD:212492 120/271 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.