DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3842 and SPCC736.13

DIOPT Version :9

Sequence 1:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_587784.1 Gene:SPCC736.13 / 2539566 PomBaseID:SPCC736.13 Length:339 Species:Schizosaccharomyces pombe


Alignment Length:302 Identity:106/302 - (35%)
Similarity:155/302 - (51%) Gaps:15/302 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 IDGKVVIVTGCNTGIGKETVLELAKRGARVYMACRDPGRCEAARLDIMDRSRNQQLFNRTLDLGS 136
            :.|||.:|||.:.|||..|.||||::||:||:|.|:..:.:.....|.|..|:.::....|||..
pombe    40 LTGKVALVTGSSGGIGYVTALELARKGAKVYLAGRNEEKYQKVMKQIHDEVRHSKIRFLRLDLLD 104

  Fly   137 LQSVRNFVERFKAEESRLDILINNAGVMACPRTLTADGFEQQFGVNHLGHFLLTNLLLDRLKHSS 201
            .:||....|.|.|:|.:|.||:||||:|..|..||.||:|.|...|:|.|:|.|.|||..|:.::
pombe   105 FESVYQAAESFIAKEEKLHILVNNAGIMNPPFELTKDGYELQIQTNYLSHYLFTELLLPTLRRTA 169

  Fly   202 PS------RIVVVSSAAHL---FGRINREDLMSEKNYSKFFGAYSQSKLANILFTLKLSTILKDT 257
            ..      |||.|:|.|:|   :..|...||.........|..|.|||.|.||:::.|:..|:..
pombe   170 EECRPGDVRIVHVASIAYLQAPYSGIYFPDLNLPHVLLGTFARYGQSKYAQILYSIALAKRLEKY 234

  Fly   258 GVTVNCCHPGVVRTEINRHFSGPGWMKTALQKGSL-YFFKTPKAGAQTQLRLALDPQL--EGSTG 319
            |:.....||||:|||:.|:  .|.:....|:|... |....|..||.|.|..|..|::  |...|
pombe   235 GIYSVSLHPGVIRTELTRY--SPTFALKLLEKSVFQYLLLDPIRGAMTSLYAATSPEISKEHLNG 297

  Fly   320 GYYSDCMRWPLFPWVRNMQTADWLWRESEKLL-GLPPLEPPP 360
            .|::...:..:.....:....:.|:|.:.|:. .|..|.|.|
pombe   298 AYFTAIAQRGILHRAHDDAFVEELYRYTHKIFEDLKYLAPSP 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3842NP_001259270.1 FabG 71..319 CDD:223959 97/258 (38%)
NADB_Rossmann 74..347 CDD:304358 101/284 (36%)
SPCC736.13NP_587784.1 retinol-DH_like_SDR_c_like 42..322 CDD:212492 99/281 (35%)
adh_short 43..252 CDD:278532 83/208 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 118 1.000 Domainoid score I1484
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 184 1.000 Inparanoid score I1096
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 1 1.000 - - otm47252
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1905
SonicParanoid 1 1.000 - - X72
TreeFam 00.000 Not matched by this tool.
109.790

Return to query results.
Submit another query.