DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3842 and Dhrsx

DIOPT Version :9

Sequence 1:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001028498.2 Gene:Dhrsx / 236082 MGIID:2181510 Length:335 Species:Mus musculus


Alignment Length:291 Identity:121/291 - (41%)
Similarity:154/291 - (52%) Gaps:21/291 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 GKVVIVTGCNTGIGKETVLELAKRGARVYMACRDPGRCEAARLDIMDRSRNQQLFNRT----LDL 134
            |:|.||||...|||:.|..:||:.|..|.:|    |..|....:::...|.:...:|.    |||
Mouse    43 GRVAIVTGATAGIGRSTARQLARLGMCVVVA----GNDEHCGQEVVSSIRAEMGSDRAHFLPLDL 103

  Fly   135 GSLQSVRNFVERFKAEESRLDILINNAGVMACPRTLTADGFEQQFGVNHLGHFLLTNLLLDRLKH 199
            .||.|||.|...|:|....|.:|:||||||..||..|.||||:..|||.|||||||.|||..|:.
Mouse   104 ASLASVRGFARDFRALGLPLHLLVNNAGVMLEPRAETEDGFERHLGVNFLGHFLLTLLLLPALRA 168

  Fly   200 SSP----SRIVVVSSAAHLFGRINREDLMSEKNYSKFFGAYSQSKLANILFTLKLSTILKDTG-- 258
            |..    ||:|.|.||.|..|.::..||.....||. :.||:|||||..||.|:|..||...|  
Mouse   169 SGAEGRGSRVVTVGSATHYVGTVDMADLHGRHAYSP-YAAYAQSKLALALFALQLQRILDARGDP 232

  Fly   259 VTVNCCHPGVVRTEINRHFSGPGWMKTALQK--GSLYFFKTPKAGAQTQLRLALDPQLEGSTGGY 321
            ||.|...||||.||:.||   .||:...:::  |.| .||:|:.||.|.:..|..|:|||..|.|
Mouse   233 VTSNMADPGVVDTELYRH---AGWVLRTVKRFLGWL-VFKSPEEGAWTLVYAAAAPELEGVGGRY 293

  Fly   322 YSDCMRWPLFPWVRNMQTADWLWRESEKLLG 352
            ..|..........|:.:....||.|..:|.|
Mouse   294 LRDEAEAEPLGTARDQELQRRLWAEGLRLTG 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3842NP_001259270.1 FabG 71..319 CDD:223959 112/256 (44%)
NADB_Rossmann 74..347 CDD:304358 118/284 (42%)
DhrsxNP_001028498.2 PRK06197 38..324 CDD:235737 120/289 (42%)
retinol-DH_like_SDR_c_like 43..316 CDD:212492 116/281 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.