DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3842 and DHRSX

DIOPT Version :9

Sequence 1:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_660160.2 Gene:DHRSX / 207063 HGNCID:18399 Length:330 Species:Homo sapiens


Alignment Length:325 Identity:128/325 - (39%)
Similarity:177/325 - (54%) Gaps:20/325 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 AVLIFLIVLGILLFMWLLRKCIQG---PAYRKANRIDGKVVIVTGCNTGIGKETVLELAKRGARV 101
            |:.::.:...::|.. |||:|..|   |.:  ..|.| :|.||||...|||..|...||:.|..|
Human    10 ALRVYAVGAAVILAQ-LLRRCRGGFLEPVF--PPRPD-RVAIVTGGTDGIGYSTAKHLARLGMHV 70

  Fly   102 YMACRDPGRCEAARLDIMDRSRNQQLFNRTLDLGSLQSVRNFVERFKAEESRLDILINNAGVMAC 166
            .:|..:..:.:.....|.:.:.|.::.....||.|:.|:|.||::||.::..|.:||||||||..
Human    71 IIAGNNDSKAKQVVSKIKEETLNDKVEFLYCDLASMTSIRQFVQKFKMKKIPLHVLINNAGVMMV 135

  Fly   167 PRTLTADGFEQQFGVNHLGHFLLTNLLLDRLKHS-SP---SRIVVVSSAAHLFGRINREDLMSEK 227
            |:..|.||||:.||:|:||||||||||||.||.| ||   :|:|.||||.|....:|.:||.|..
Human   136 PQRKTRDGFEEHFGLNYLGHFLLTNLLLDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQSSA 200

  Fly   228 NYSKFFGAYSQSKLANILFTLKLSTILKDTG--VTVNCCHPGVVRTEINRHFSGPGWMKTALQKG 290
            .||. ..||:|||||.:|||..|..:|...|  ||.|...||||.|::.:|.    :..|.|.|.
Human   201 CYSP-HAAYAQSKLALVLFTYHLQRLLAAEGSHVTANVVDPGVVNTDVYKHV----FWATRLAKK 260

  Fly   291 SL--YFFKTPKAGAQTQLRLALDPQLEGSTGGYYSDCMRWPLFPWVRNMQTADWLWRESEKLLGL 353
            .|  ..||||..||.|.:..|:.|:|||..|.|..:...........|.:....||.:|.::.|:
Human   261 LLGWLLFKTPDEGAWTSIYAAVTPELEGVGGHYLYNEKETKSLHVTYNQKLQQQLWSKSCEMTGV 325

  Fly   354  353
            Human   326  325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3842NP_001259270.1 FabG 71..319 CDD:223959 113/255 (44%)
NADB_Rossmann 74..347 CDD:304358 116/280 (41%)
DHRSXNP_660160.2 PRK06197 39..325 CDD:235737 119/291 (41%)
retinol-DH_like_SDR_c_like 43..316 CDD:212492 115/278 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.