DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3842 and dhs-24

DIOPT Version :9

Sequence 1:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_507860.3 Gene:dhs-24 / 180306 WormBaseID:WBGene00000987 Length:384 Species:Caenorhabditis elegans


Alignment Length:370 Identity:116/370 - (31%)
Similarity:162/370 - (43%) Gaps:70/370 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EAATPPGSVPGTVFPPGFDPTAESVEKTLCFRGFWAWAVLIFLIVLGILLFMWLLRKCIQGPAYR 67
            :..|.|.||..:.|             .|.:.|:..|                  .....|..|.
 Worm     8 QGLTSPWSVGFSAF-------------GLAYGGYHVW------------------DSTQSGTKYD 41

  Fly    68 KANRIDGKVVIVTGCNTGIGKETVLELAKRGARVYMACRDPGRCEAARLDIMDRSRNQQLFNRTL 132
            ....:.||..||||..:|||:.|..|||||.|||.||||:..:|...|.||:..:||:|::.|..
 Worm    42 LHEDLAGKTYIVTGATSGIGQATAEELAKRNARVIMACRNREKCVQVRRDIVLNTRNKQVYCRQC 106

  Fly   133 DLGSLQSVRNFVERF---KAEESRLDILINNAGVMACPRTLTADGFEQQFGVNHLGHFLLTNLLL 194
            ||....|:|.||::.   |.|..|:|.:::||.:|...|.:..||.|:....||||.||||.|||
 Worm   107 DLEDFDSIRTFVQKLSKGKFELDRIDGIVHNAAMMQSERAVNKDGIEKTIATNHLGSFLLTGLLL 171

  Fly   195 DR-LKHSSPSRIVVVSSAAHLFGR---INREDLMSEKNYSKFFG--AYSQSKLANILFTLKLSTI 253
            |: |...:|.|||.::|  ::..|   :|..|..||....||.|  .|..||||:.|||.:||..
 Worm   172 DKLLAQPNPVRIVFLNS--NIIDRKCDLNLADFNSENAGKKFDGYEIYKHSKLASALFTKELSER 234

  Fly   254 LKDTGVTVNCCHPGVVRTEINRHFSG-----PGWMKTALQKGSLYFFKTPKAGAQTQLRLALDPQ 313
            |.||.:.|....||..::.::....|     ..|:...:..| :...:|.|| .:..|....||.
 Worm   235 LSDTNIHVLMADPGRTKSNLSAQMDGQTFFLSRWLLKIVSFG-MGERRTEKA-VRPVLFALCDPD 297

  Fly   314 LEGSTGGYYSDCMRWPLF--------PW---VRNMQTADWLWRES 347
            .....|          ||        ||   :.:....:.||..|
 Worm   298 TSDENG----------LFIDRERHQQPWNDVIMDAAKREKLWNVS 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3842NP_001259270.1 FabG 71..319 CDD:223959 98/261 (38%)
NADB_Rossmann 74..347 CDD:304358 105/297 (35%)
dhs-24NP_507860.3 FabG 45..306 CDD:223959 100/274 (36%)
retinol-DH_like_SDR_c_like 48..329 CDD:212492 103/294 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.