DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3842 and dhs-17

DIOPT Version :9

Sequence 1:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001041109.1 Gene:dhs-17 / 178990 WormBaseID:WBGene00000980 Length:286 Species:Caenorhabditis elegans


Alignment Length:299 Identity:82/299 - (27%)
Similarity:127/299 - (42%) Gaps:48/299 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 KVVIVTGCNTGIGKETVLELAKRGAR-VYMACRDPGRCEAARLDIMDRSRNQQLFNRTL-DLGSL 137
            :.:::||...||||:|.|:||..... |.:..|...:|.|.:..|...:.|....:... |...|
 Worm     8 RTILITGATDGIGKQTALDLAAHPDNFVIIHGRTEEKCIATKDWIGKENGNCSNIDYVAGDFAVL 72

  Fly   138 QSVRNFVERFKAEESRLDILINNAGVMACPRTLTADGFEQQFGVNHLGHFLLTNLLLDRLKHSSP 202
            :.|....|..:.....|::|:.||||:...|..|.||.|..|.||:|.|:||.||||..|.|:. 
 Worm    73 KEVAIIAEEVERRFPELNVLLCNAGVLYPRRLETKDGMESTFQVNYLAHYLLCNLLLPVLSHNR- 136

  Fly   203 SRIVVVSSAAHLFGRINREDLMSEKNYSKFFGAYSQSKLANILFTLKLSTILKDTGVTVNCCHPG 267
            |.::||.|..|.:..::..|:|:.|.|.|:. .||:|||...|....|...:            .
 Worm   137 SNVIVVGSVLHTWPSLDWADVMATKEYEKYL-QYSRSKLMCHLMAFALHRRM------------N 188

  Fly   268 VVRTEINRHFSGPGWMKTALQKGSLYFFKTPKAGAQTQLRLAL------------DPQLEGSTGG 320
            :.|..:|.:....|..|.....|.|   :|..|.:.:...|::            .|.||..:|.
 Worm   189 IARQHVNVNIIELGKEKEPNNNGKL---RTTSALSSSMSTLSICRQAGNLAQLIEGPCLEKISGK 250

  Fly   321 YYSDCMRWPLFPWVRNMQTA---------DWLWRESEKL 350
            |        |.|..:.|::.         :.||..|::|
 Worm   251 Y--------LDPSGKQMRSGSDATDERLQERLWAYSKEL 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3842NP_001259270.1 FabG 71..319 CDD:223959 73/257 (28%)
NADB_Rossmann 74..347 CDD:304358 80/294 (27%)
dhs-17NP_001041109.1 retinol-DH_like_SDR_c_like 7..275 CDD:212492 78/291 (27%)
PRK06197 8..281 CDD:235737 81/297 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.