DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3842 and RDH12

DIOPT Version :9

Sequence 1:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_689656.2 Gene:RDH12 / 145226 HGNCID:19977 Length:316 Species:Homo sapiens


Alignment Length:317 Identity:163/317 - (51%)
Similarity:206/317 - (64%) Gaps:13/317 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LIVLGILL----FMWL----LRKCIQGPAYRKANRIDGKVVIVTGCNTGIGKETVLELAKRGARV 101
            |:.||:|.    |:::    :||...|...|...::.||||::||.||||||||..|||.|||||
Human     2 LVTLGLLTSFFSFLYMVAPSIRKFFAGGVCRTNVQLPGKVVVITGANTGIGKETARELASRGARV 66

  Fly   102 YMACRDPGRCEAARLDIMDRSRNQQLFNRTLDLGSLQSVRNFVERFKAEESRLDILINNAGVMAC 166
            |:||||..:.|:|..:|...::|.|:..|.|||...:|:|.|.|.|.|||.:|.|||||||||.|
Human    67 YIACRDVLKGESAASEIRVDTKNSQVLVRKLDLSDTKSIRAFAEGFLAEEKQLHILINNAGVMMC 131

  Fly   167 PRTLTADGFEQQFGVNHLGHFLLTNLLLDRLKHSSPSRIVVVSSAAHLFGRINREDLMSEKNYSK 231
            |.:.||||||...|||||||||||.|||:|||.|:|:|:|.|||.||..|:|...||.|||.||:
Human   132 PYSKTADGFETHLGVNHLGHFLLTYLLLERLKVSAPARVVNVSSVAHHIGKIPFHDLQSEKRYSR 196

  Fly   232 FFGAYSQSKLANILFTLKLSTILKDTGVTVNCCHPGVVRTEINRHFSGPGWMKTALQKGSLYFFK 296
            .| ||..|||||:|||.:|:..|:.||||....||||||:|:.||.|    :...|.:....|.|
Human   197 GF-AYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGVVRSELVRHSS----LLCLLWRLFSPFVK 256

  Fly   297 TPKAGAQTQLRLALDPQLEGSTGGYYSDCMRWPLFPWVRNMQTADWLWRESEKLLGL 353
            |.:.||||.|..||...||..:|.|:|||.|..:.|..||.:||:.||..|.:|||:
Human   257 TAREGAQTSLHCALAEGLEPLSGKYFSDCKRTWVSPRARNNKTAERLWNVSCELLGI 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3842NP_001259270.1 FabG 71..319 CDD:223959 137/247 (55%)
NADB_Rossmann 74..347 CDD:304358 150/272 (55%)
RDH12NP_689656.2 retinol-DH_like_SDR_c 39..307 CDD:212495 150/272 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 1 1.100 - - O PTHR24320
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1905
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.820

Return to query results.
Submit another query.