DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3842 and wwox

DIOPT Version :9

Sequence 1:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_017948987.1 Gene:wwox / 100145151 XenbaseID:XB-GENE-5721345 Length:414 Species:Xenopus tropicalis


Alignment Length:289 Identity:119/289 - (41%)
Similarity:166/289 - (57%) Gaps:14/289 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 IDGKVVIVTGCNTGIGKETVLELAKRGARVYMACRDPGRCEAARLDIMDRSRNQQLFNRTLDLGS 136
            :.||||||||.|||||.||...||..|..|.:|||:..:...|:..|::.....::...:|||.|
 Frog   122 LSGKVVIVTGANTGIGFETARSLALHGTLVILACRNLQKGNEAKHKILEEWHKAKVEVMSLDLAS 186

  Fly   137 LQSVRNFVERFKAEESRLDILINNAGVMACPRTLTADGFEQQFGVNHLGHFLLTNLLLDRLKHSS 201
            |:||::|.|.||:....|.:||.||..:..|..||.||.|..|.|||||||.|.:||.|.|:.|.
 Frog   187 LRSVQSFAEAFKSRNLALHVLICNAAYLGGPWQLTEDGLEMTFQVNHLGHFYLVSLLQDVLQRSI 251

  Fly   202 PSRIVVVSSAAHLFGRINRE------DLMS--EKNYSKFFGAYSQSKLANILFTLKLSTILKDTG 258
            |||:|||||.:|.|..|...      :|:|  :|:|.... ||::|||.||||:.:|:..|...|
 Frog   252 PSRVVVVSSESHRFTEIKDSSGKLDLNLLSPLKKDYWAML-AYNRSKLCNILFSKELNRRLSPHG 315

  Fly   259 VTVNCCHPG-VVRTEINRHFSGPGWMKTALQKGSLYFFKTPKAGAQTQLRLALDPQLEGSTGGYY 322
            ||.|..||| ::.:.|:|::    |..|.|......|.|:.:.||.|.:..|:.|:|||..|.|:
 Frog   316 VTSNAVHPGNMMYSSIHRNW----WGYTLLFALVRPFTKSMQQGASTSVYCAVSPELEGLGGMYF 376

  Fly   323 SDCMRWPLFPWVRNMQTADWLWRESEKLL 351
            ::|.|.......:..:||..||..||:|:
 Frog   377 NNCCRCLPSQEAQREETAAALWELSERLI 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3842NP_001259270.1 FabG 71..319 CDD:223959 108/255 (42%)
NADB_Rossmann 74..347 CDD:304358 116/281 (41%)
wwoxXP_017948987.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.