DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and SEC14

DIOPT Version :9

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_013796.1 Gene:SEC14 / 855103 SGDID:S000004684 Length:304 Species:Saccharomyces cerevisiae


Alignment Length:312 Identity:58/312 - (18%)
Similarity:101/312 - (32%) Gaps:106/312 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVHLNEKAEDQLMTTRISDLQDWLQAQPQLPQNISRLLLRRFLHTTRGDLSAAQRLLE------L 59
            :..|.:..||.....|:.|               |.||  |||...:.|:..|:.:.|      .
Yeast    37 LAELRKLLEDAGFIERLDD---------------STLL--RFLRARKFDVQLAKEMFENCEKWRK 84

  Fly    60 NYGLRNKHAHIFIDRDPLDASSQQLLQVADLVPLPGLTPENNKLLFYRLIDFDADK--FNFTAAI 122
            :||..........|..||         :|...|           .:|...|.|...  |....|:
Yeast    85 DYGTDTILQDFHYDEKPL---------IAKFYP-----------QYYHKTDKDGRPVYFEELGAV 129

  Fly   123 KVFFMVADCRFATENEERLSDGEIPVFD------------MAGY------TLRHLTKTALGALRV 169
            .:..|     ....:|||:....:..::            .||:      |:..|...::.:...
Yeast   130 NLHEM-----NKVTSEERMLKNLVWEYESVVQYRLPACSRAAGHLVETSCTIMDLKGISISSAYS 189

  Fly   170 YMKFVQEA-------HPVRLKEIHVLNCPSYVDKVMAVVKPFIK----GEVFKLIHFHLPNADTP 223
            .|.:|:||       :|.|:.:.:::|.|........:.|||:.    .::|.|        .:.
Yeast   190 VMSYVREASYISQNYYPERMGKFYIINAPFGFSTAFRLFKPFLDPVTVSKIFIL--------GSS 246

  Fly   224 Y-----RHFPRSMLPEEYGGEAGKMSDLKLQWMQLLKEQRD--YLMDTENWQ 268
            |     :..|...||.::||::.            :.|.:.  ||.|...|:
Yeast   247 YQKELLKQIPAENLPVKFGGKSE------------VDESKGGLYLSDIGPWR 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:238099 32/184 (17%)
SEC14NP_013796.1 CRAL_TRIO_N 34..79 CDD:215024 14/58 (24%)
SEC14 99..269 CDD:214706 36/202 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.