DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and SFH5

DIOPT Version :9

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_012390.1 Gene:SFH5 / 853296 SGDID:S000003681 Length:294 Species:Saccharomyces cerevisiae


Alignment Length:167 Identity:30/167 - (17%)
Similarity:55/167 - (32%) Gaps:69/167 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 NKLLFYR---------LIDFDADKFNFTAAIKVFFMVADCRFATENEERLSDGEIPVFDMAGYTL 156
            :|.:.||         |:||.:...|:...:..:..|:..|..::                   :
Yeast   142 DKFVRYRIGLMEKGLSLLDFTSSDNNYMTQVHDYKGVSVWRMDSD-------------------I 187

  Fly   157 RHLTKTALGALRVYMKFVQEAHPVRLKEIHVLNCPSYVDKVMAVVKPFIK--------------- 206
            ::.:||.:|..:.|       :|..|...:.:|.|:....|..::|.|:.               
Yeast   188 KNCSKTVIGIFQKY-------YPELLYAKYFVNVPTVFGWVYDLIKKFVDETTRKKFVVLTDGSK 245

  Fly   207 -GEVFKLIHFHLPNADTPYRHFPRSMLPEEYGGEAGK 242
             |:..|         |.||         |.|||:..|
Yeast   246 LGQYLK---------DCPY---------EGYGGKDKK 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:238099 28/162 (17%)
SFH5NP_012390.1 SEC14 101..263 CDD:214706 29/164 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.