DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and AT4G08690

DIOPT Version :9

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001031598.1 Gene:AT4G08690 / 826436 AraportID:AT4G08690 Length:301 Species:Arabidopsis thaliana


Alignment Length:292 Identity:54/292 - (18%)
Similarity:108/292 - (36%) Gaps:77/292 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LPQNISRL----LLRRFLHTTRGDLSAAQRLLE--LNYGLRNKHAHIFIDRDPLDASSQQLLQ-- 86
            ||:.:|..    .:.|:|......:..|.::|:  |.:.::.|...|..:....:|.:.::.:  
plant    33 LPEKLSSFCSDDAVLRYLRARNWHVKKATKMLKETLKWRVQYKPEEICWEEVAGEAETGKIYRSS 97

  Fly    87 VADLVPLPGL----TPENNKLLFYRLIDFDADKFNFTAAIK--VFFMVADCRFATENE-ERLSDG 144
            ..|.:..|.|    :.||:|                  ::|  :.::|    :..||. :.|..|
plant    98 CVDKLGRPVLIMRPSVENSK------------------SVKGQIRYLV----YCMENAVQNLPPG 140

  Fly   145 E---IPVFDMAGYTLRHLTKTALGALRVYMKFVQEAHPVRLKEIHVLNCPSYVDKVMAVVKPFIK 206
            |   :.:.|..||:|.::   :|...:.....:||.:|.||....:.|.|.:.:....|.:||::
plant   141 EEQMVWMIDFHGYSLANV---SLRTTKETAHVLQEHYPERLAFAVLYNPPKFFEPFWKVARPFLE 202

  Fly   207 GEV---FKLIHFHLPNADT-PYRHFPRSMLPEEYGGEAGKMSDLKLQWMQLLKEQRDYLMDTENW 267
            .:.   .|.::...||... ...:|....:...:||.                       |...:
plant   203 PKTRNKVKFVYSDDPNTKVIMEENFDMEKMELAFGGN-----------------------DDSGF 244

  Fly   268 QINKIKKNGQRKSSDS----GVTEGLRSLEID 295
               .|:|:.:|...|.    ...||:.|..:|
plant   245 ---NIEKHSERMKEDDKKRLASLEGIVSASLD 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:238099 32/162 (20%)
AT4G08690NP_001031598.1 CRAL_TRIO_N 20..67 CDD:215024 7/33 (21%)
SEC14 87..241 CDD:214706 35/201 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053004at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.