DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and AT3G22410

DIOPT Version :9

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_188880.1 Gene:AT3G22410 / 821809 AraportID:AT3G22410 Length:400 Species:Arabidopsis thaliana


Alignment Length:177 Identity:34/177 - (19%)
Similarity:71/177 - (40%) Gaps:19/177 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SRLLLRRFLHTTRGDLSAAQRLLELNYGLRNKHAHIFIDRDPLDASSQQLLQVADLVP-LPGLTP 98
            :|..:.|||.....::..|.:.|......|.   :..|:|...:..|.:|   :|.|. :.|...
plant    30 NRECVERFLKVKGDNVKKAAKQLSSCLSWRQ---NFDIERLGAEEFSTEL---SDGVAYISGHDR 88

  Fly    99 ENNKLLFYRLIDFDADKFN----FTAAIKVFFMVADCRFATENEERLSDGEIPVFDMAGYTLRHL 159
            |:..::.:| ...|..|.:    ||..:......|....:...|:..    :.:||.:.:   ..
plant    89 ESRPVIIFR-FKHDYQKLHTQKQFTRLVAFTIETAISSMSRNTEQSF----VLLFDASFF---RS 145

  Fly   160 TKTALGALRVYMKFVQEAHPVRLKEIHVLNCPSYVDKVMAVVKPFIK 206
            :......|...:|.:.:.:|.||.:..:::.||:...:...|:||::
plant   146 SSAFANLLLATLKIIADNYPCRLYKAFIIDPPSFFSYLWKGVRPFVE 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:238099 22/122 (18%)
AT3G22410NP_188880.1 SEC14 78..209 CDD:238099 23/123 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053004at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.