DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and TTPAL

DIOPT Version :9

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001034288.1 Gene:TTPAL / 79183 HGNCID:16114 Length:342 Species:Homo sapiens


Alignment Length:264 Identity:65/264 - (24%)
Similarity:119/264 - (45%) Gaps:23/264 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LNEKAEDQLMTTRISDLQDWLQAQ-PQLPQNISRLLLRRFLHTTRGDLSAAQRLLELNYGLRNKH 67
            |.||.|.:|..  :..|:|.::.: |.|..::....|.|||...:.|...|.:||...:..|...
Human    47 LQEKPEWRLRD--VQALRDMVRKEYPNLSTSLDDAFLLRFLRARKFDYDRALQLLVNYHSCRRSW 109

  Fly    68 AHIFIDRDPLDASSQQLLQVADLVPLPGLTPENNKLLFYRLIDFDADKFNFTAAIKVFFMVADCR 132
            ..:|.:..|  ::.:.:|....|..||...|....::..|...:....:..|..|:..::..:  
Human   110 PEVFNNLKP--SALKDVLASGFLTVLPHTDPRGCHVVCIRPDRWIPSNYPITENIRAIYLTLE-- 170

  Fly   133 FATENEERLSDGEIPVFDMAGYTLR-------HLTKTALGALRVYMKFVQEAHPVRLKEIHVLNC 190
            ...::||...:|.:.:.|..|.:|.       .:.|..:|.|       |:..|:|:|.:||:|.
Human   171 KLIQSEETQVNGIVILADYKGVSLSKASHFGPFIAKKVIGIL-------QDGFPIRIKAVHVVNE 228

  Fly   191 PSYVDKVMAVVKPFIKGEVFKLIHFHLPNADTPYRHFPRSMLPEEYGGEAGKMSDLKLQWMQLLK 255
            |.....:.|::|||:|.::......|..:.::.:.:.|||:||:||||.||::.  ...|..:|.
Human   229 PRIFKGIFAIIKPFLKEKIANRFFLHGSDLNSLHTNLPRSILPKEYGGTAGELD--TATWNAVLL 291

  Fly   256 EQRD 259
            ...|
Human   292 ASED 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:238099 38/155 (25%)
TTPALNP_001034288.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
CRAL_TRIO_N 56..102 CDD:215024 12/47 (26%)
SEC14 121..277 CDD:238099 39/164 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.