DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and SEC14L6

DIOPT Version :9

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_016884420.1 Gene:SEC14L6 / 730005 HGNCID:40047 Length:432 Species:Homo sapiens


Alignment Length:362 Identity:72/362 - (19%)
Similarity:115/362 - (31%) Gaps:106/362 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LNEKAEDQLMTTRISDLQDWLQAQPQLPQNISRLLLRRFLHTTRGDLSAAQRLLELNYGLRNKH- 67
            |:...|..|...| .::||.|.|.|    |.....|.|:|.....||..::.:|..:...|.:. 
Human    11 LSPSQEKSLAQFR-ENIQDVLSALP----NPDDYFLLRWLQARSFDLQKSEDMLRKHMEFRKQQD 70

  Fly    68 --------------------------------AHIFIDRDP----LDASSQQLLQVADLVPLPGL 96
                                            .||....||    |.||.|:||:          
Human    71 LANILAWQPPEVVRLYNANGICGHDGEGSPVWYHIVGSLDPKGLLLSASKQELLR---------- 125

  Fly    97 TPENNKLLFYRLIDFDADKFNFTAAIKVFFMV---ADCRFA----TENEERLS---DGEIPVFDM 151
            ....:..|..|..:..:.|.::|....:...:   .:|..|    .:..:.|.   :..|.:|.:
Human   126 DSFRSCELLLRECELQSQKPHWTRGTGISAPLDRRGNCNTAIWPPMDRHKELGKRVEKIIAIFGL 190

  Fly   152 AGYTLRHLTKTALGALRVYMKFVQEAHPVRLKEIHVLNCPSYVDKVMAVVKPFI----------- 205
            .|..||.|.|..:..|:.:...::..:|..||.:.|:..|........:||.::           
Human   191 EGLGLRDLWKPGIELLQEFFSALEANYPEILKSLIVVRAPKLFAVAFNLVKSYMSEETRRKVVIL 255

  Fly   206 ----KGEVFKLIH-FHLP----NADTPYRHFPRSMLPEEYGGEAGK----MSDLKLQWMQLLKEQ 257
                |.|:.|.|. ..||    ...|.....|:.:....||||..|    ...::||:.......
Human   256 GDNWKQELTKFISPDQLPVEFGGTMTDPDGNPKCLTKINYGGEVPKSYYLCKQVRLQYEHTRSVG 320

  Fly   258 RDYLMDTEN----------WQINKIKKNGQRKSSDSG 284
            |...:..||          ||.          :||.|
Human   321 RGSSLQVENEILFPGCVLRWQF----------ASDGG 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:238099 32/178 (18%)
SEC14L6XP_016884420.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.