DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and TTPA

DIOPT Version :9

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_000361.1 Gene:TTPA / 7274 HGNCID:12404 Length:278 Species:Homo sapiens


Alignment Length:241 Identity:64/241 - (26%)
Similarity:108/241 - (44%) Gaps:18/241 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PQLPQNISRLLLRRFLHTTRGDLSAAQRLLELNYGLRNKHAHIFIDRDP------LDASSQQLLQ 86
            |..|..::...|.|||.....||..|.|||:..|..|.:...|..|..|      |.|....:|:
Human    41 PLAPLPLTDSFLLRFLRARDFDLDLAWRLLKNYYKWRAECPEISADLHPRSIIGLLKAGYHGVLR 105

  Fly    87 VADLVPLPGLTPENNKLLFYRLIDFDADKFNFTAAIKVFFMVADCRFATENEERLSDGEIPVFDM 151
            ..|        |..:|:|.||:..:|...|......:|..:.::  ...:..|...:|...:||:
Human   106 SRD--------PTGSKVLIYRIAHWDPKVFTAYDVFRVSLITSE--LIVQEVETQRNGIKAIFDL 160

  Fly   152 AGYTLRHLTKTALGALRVYMKFVQEAHPVRLKEIHVLNCPSYVDKVMAVVKPFIKGEVFKLIHFH 216
            .|:...|..:......:.....:.::.|::::.||::|.|.....|.:::|||:..::.:.||.|
Human   161 EGWQFSHAFQITPSVAKKIAAVLTDSFPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKERIHMH 225

  Fly   217 LPN-ADTPYRHFPRSMLPEEYGGEAGKMSDLKLQWMQLLKEQRDYL 261
            ..| ..:..:||| .:||.|||||...|.|:..:|...:.:..|||
Human   226 GNNYKQSLLQHFP-DILPLEYGGEEFSMEDICQEWTNFIMKSEDYL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:238099 35/149 (23%)
TTPANP_000361.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
CRAL_TRIO_N <40..73 CDD:215024 12/31 (39%)
CRAL_TRIO 99..248 CDD:395525 37/159 (23%)
Phosphatidylinositol 3,4-bisphosphate binding. /evidence=ECO:0000250|UniProtKB:Q8BWP5 190..192 0/1 (0%)
Phosphatidylinositol 4,5-bisphosphate binding. /evidence=ECO:0000250|UniProtKB:Q8BWP5 208..211 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053004at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.