DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and SEC14L1

DIOPT Version :9

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001034662.3 Gene:SEC14L1 / 6397 HGNCID:10698 Length:719 Species:Homo sapiens


Alignment Length:267 Identity:53/267 - (19%)
Similarity:91/267 - (34%) Gaps:85/267 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LQDWLQA--QPQLPQNISRLLLRRFLHTTRGDLSAAQRLLELNYGLRNKHAHIFI---------- 72
            |:.|||.  :.::|::...|   |||.....::..|:.::..:...|.:|...:|          
Human   262 LRQWLQETHKGKIPKDEHIL---RFLRARDFNIDKAREIMCQSLTWRKQHQVDYILETWTPPQVL 323

  Fly    73 -----------DRD--PLDASSQQLLQVADLVPLPGLTPENNKLLFYRLIDFDADKFNFTAAIKV 124
                       |:|  ||.......:....||...|    ...||.|.|                
Human   324 QDYYAGGWHHHDKDGRPLYVLRLGQMDTKGLVRALG----EEALLRYVL---------------- 368

  Fly   125 FFMVADCRFATENEE--RLSDGEIPVF-----------DMAGYTLRHLTKTALGALRVYMKFVQE 176
                      :.|||  |..:....||           |:.|..:|||.:..:.||...::.|:.
Human   369 ----------SINEEGLRRCEENTKVFGRPISSWTCLVDLEGLNMRHLWRPGVKALLRIIEVVEA 423

  Fly   177 AHPVRLKEIHVLNCPSYVDKVMAVVKPFIKGEVFK--LIHFHLPNADTPYR-------HFPRSML 232
            .:|..|..:.:|..|.....:..:|.|||.....:  ||:     |...|:       :..:.::
Human   424 NYPETLGRLLILRAPRVFPVLWTLVSPFIDDNTRRKFLIY-----AGNDYQGPGGLLDYIDKEII 483

  Fly   233 PEEYGGE 239
            |:...||
Human   484 PDFLSGE 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:238099 34/170 (20%)
SEC14L1NP_001034662.3 PRELI 17..173 CDD:368069
CRAL_TRIO_N 256..301 CDD:215024 10/41 (24%)
CRAL_TRIO 326..490 CDD:366224 38/198 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.