DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and sec14l8

DIOPT Version :9

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001093463.1 Gene:sec14l8 / 558964 ZFINID:ZDB-GENE-060526-180 Length:395 Species:Danio rerio


Alignment Length:261 Identity:58/261 - (22%)
Similarity:102/261 - (39%) Gaps:41/261 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 MTTRISDL---------------QDWLQAQPQLPQNISRLLLRRFLHTTRGDLSAAQRLLELNYG 62
            |:.|:.||               ||.|   ||.|......|| |:|.....:|..::.:|..:..
Zfish     1 MSGRVGDLSVKQAEALAQFREKVQDVL---PQCPSQSDHFLL-RWLRARNFNLQKSEAMLRKHIE 61

  Fly    63 LRNKHAHIFIDRDPLDASSQQLLQVADLVPLPGLTPENNK--LLFYRLIDFDADKFNFTAAIK-- 123
            .| ||..:    |.: .:..|:.:|.|.....|:...:.:  .::|.:|.....|....:|.|  
Zfish    62 FR-KHMKV----DTI-TTEWQVPEVIDKYLSGGMCGHDREGSPVWYDVIGPLDPKGLMHSASKQD 120

  Fly   124 -VFFMVADCRFATENEERLS-------DGEIPVFDMAGYTLRHLTKTALGALRVYMKFVQEAHPV 180
             :...|.||....::.:|.|       :....|:|..|..::||.|.|:......:...::.:|.
Zfish   121 LIKSKVRDCEILQKDCDRQSERLGRNIESITMVYDCEGLGMKHLYKPAIETYGEVLTMFEDNYPE 185

  Fly   181 RLKEIHVLNCPSYVDKVMAVVKPFIKGEV-FKLIHFHLPNADTPYRHFPRSMLPEEYGGEAGKMS 244
            .||.:.|:..|........:||.|:..:. .|:|.......:...::.....||..||   ||::
Zfish   186 GLKRLFVIKAPKLFPVAYNLVKHFLSEDTRRKVIVLGSNWQEVLQKYIDPEELPAYYG---GKLT 247

  Fly   245 D 245
            |
Zfish   248 D 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:238099 32/161 (20%)
sec14l8NP_001093463.1 CRAL_TRIO_N 13..59 CDD:215024 12/49 (24%)
SEC14 78..246 CDD:214706 35/170 (21%)
GOLD_2 304..382 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.