DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and ttpa

DIOPT Version :9

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_012820030.1 Gene:ttpa / 493547 XenbaseID:XB-GENE-953693 Length:285 Species:Xenopus tropicalis


Alignment Length:279 Identity:75/279 - (26%)
Similarity:127/279 - (45%) Gaps:28/279 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LNEKAEDQLMTTR--ISDLQDWLQAQPQL-PQNISRLLLRRFLHTTRGDLSAAQRLLELNYGLRN 65
            ||| ..||....|  ||.::...:|...: |..:|...|.|||......:..|.:||:..:..|.
 Frog    15 LNE-LPDQAPVVREAISIIRKRAEADSAIWPLGLSDDFLLRFLRARDFCIELAFKLLKNYHKWRA 78

  Fly    66 KHAHIFIDRDP---LD---ASSQQLLQVADLVPLPGLTPENNKLLFYRLIDFDADKFNFTAAIKV 124
            :...|..|..|   ||   |....:|:..|        ...:|:|.||:..:|...|......:|
 Frog    79 ECPEITADLRPSPILDLFRAGYHAVLRSRD--------DSGSKVLIYRIEYWDPKLFTAYEVFRV 135

  Fly   125 FFMVADCRFATENEERLSDGEIPVFDMAGYTLRH---LTKTALGALRVYMKFVQEAHPVRLKEIH 186
            ..:.::  ...:..|...:|...:||:.|:.|.|   :|.|....:...|   .::.|::::.:|
 Frog   136 SLITSE--LIVQEAETQRNGIKAIFDLQGWRLAHAFQITPTMAKRIAAVM---ADSFPLKVRGVH 195

  Fly   187 VLNCPSYVDKVMAVVKPFIKGEVFKLIHFHLPN-ADTPYRHFPRSMLPEEYGGEAGKMSDLKLQW 250
            ::|.|.:...|.|::|||:..::.:.:|.|..| ..|..:||..|:||.||||....||:|..:|
 Frog   196 LINEPLFFHPVFAIIKPFLPDKIKQRVHMHGSNYIPTLNQHFSTSILPPEYGGTGPAMSELCEEW 260

  Fly   251 MQLLKEQRDYLMD-TENWQ 268
            ...:....|||:. ::|.|
 Frog   261 TAHIMSSEDYLLSISQNKQ 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:238099 38/152 (25%)
ttpaXP_012820030.1 CRAL_TRIO_N 27..73 CDD:215024 12/45 (27%)
CRAL_TRIO 99..249 CDD:366224 40/162 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053004at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.