DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and rlbp1b

DIOPT Version :9

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_991253.1 Gene:rlbp1b / 402990 ZFINID:ZDB-GENE-040426-1870 Length:307 Species:Danio rerio


Alignment Length:261 Identity:48/261 - (18%)
Similarity:118/261 - (45%) Gaps:29/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HLNEKAEDQL------MTTRISDLQDWLQAQPQLPQNISR-----------LLLRRFLHTTRGDL 50
            |..:||:|:|      .|:.:.:|:..::.:.:....:::           .:|.||:...:.|:
Zfish    43 HTMQKAKDELNETDEKRTSAVKELRGIIKEKAETGDELAKGVQDTFGEKPDGVLVRFIRARKYDV 107

  Fly    51 SAAQRLLELNYGLRNKHAHIFIDRDPLDASSQQLLQVADLVPLPGLTPENNK----LLFYRLIDF 111
            :.|..|::.....|..:..:|.:..|      :.::.......||:....:|    :|.:.:.::
Zfish   108 NRAYELMKGYVRFRRDYPELFENLTP------EAVRSTIEAGYPGILSSRDKYGRVVLLFNIENW 166

  Fly   112 DADKFNFTAAIKVFFMVADCRFATENEERLSDGEIPVFDMAGYTLRHLTKTALGALRVYMKFVQE 176
            |.::..|...::.:.::.:  ...||||...:|...:.:..|:|::..:......|:..:..:|:
Zfish   167 DYEEITFDEILRAYCVILE--KLLENEETQINGFCIIENFKGFTMQQASGIKPTELKKMVDMLQD 229

  Fly   177 AHPVRLKEIHVLNCPSYVDKVMAVVKPFIKGEVFKLIHFHLPNADTPYRHFPRSMLPEEYGGEAG 241
            :.|.|.|.:|.::.|.|......||||.:|.::.:.:..|..:.:..::.|...:||.::.|:..
Zfish   230 SFPARFKAVHFIHQPWYFTTTYNVVKPLMKSKLLERVFVHGDDLENYFKEFDAEILPSDFDGKGS 294

  Fly   242 K 242
            |
Zfish   295 K 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:238099 30/152 (20%)
rlbp1bNP_991253.1 CRAL_TRIO_N 60..117 CDD:215024 8/56 (14%)
CRAL_TRIO 143..292 CDD:279044 30/150 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579388
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.