DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and CG33523

DIOPT Version :9

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster


Alignment Length:216 Identity:47/216 - (21%)
Similarity:83/216 - (38%) Gaps:37/216 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RISDLQDWLQ--------AQPQLPQNISR-----LLLRRFLHTTRGDLSAAQRLLELNYGLRNKH 67
            :|.:|:|...        |.|..|.:|.|     |.|:|||.....|:..:...|.....||...
  Fly    12 QIEELRDRFNRKYASSPPAAPFHPTDIDRIRNDHLWLQRFLEMYDLDMETSFNSLWETCILRQST 76

  Fly    68 AHIFIDRDPLDASSQQLLQVADLVPLPGLTPENNKLLFYRLIDFDADKFNFTAAIKVFFMVADCR 132
            ....||...|   :|:.|:... |.:.....:...||.:| :...:...|....|::.....:  
  Fly    77 GANDIDESEL---NQEYLKEGS-VFVHNTDVDGKPLLVFR-VKMHSKSKNLDELIRIVVYWVE-- 134

  Fly   133 FATENEERLSDGEIPVFDMAGYTLRHLTKTALGALRVYMKFVQEAHPVRLKEIHVLNCPSYVDKV 197
             .|:.|:.|:...| .|||:|.:|..:.          ::||:     |:.|......|:.::.:
  Fly   135 -RTQREQHLTQLTI-FFDMSGTSLASMD----------LEFVK-----RIVETFKQFYPNSLNYI 182

  Fly   198 MAVVKPFIKGEVFKLIHFHLP 218
            :.....::....||:|...||
  Fly   183 LVYELGWVLNAAFKVIKAVLP 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:238099 25/129 (19%)
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044 25/131 (19%)
Motile_Sperm 293..396 CDD:279029
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.