DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and CG32485

DIOPT Version :9

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster


Alignment Length:237 Identity:49/237 - (20%)
Similarity:89/237 - (37%) Gaps:53/237 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 AEDQLMTTRISDLQDW-------LQAQPQLPQNISRLLLRRFLHTTRGDLSAAQRLLELN----- 60
            :.::|......|.:|.       ::|.|:  |..:...|||:|...:....|.|.:|:.|     
  Fly     2 SSEELAPINEQDFKDLKERMKLIVEADPK--QYHNDFSLRRYLRAFKTTDDAFQAILKTNKWRET 64

  Fly    61 YGLRNKHAHIFIDRDPLDASSQQLLQVADLVPLPGL-TPENNKLLFYRLIDFDADK------FNF 118
            ||: :|.:.  :||..||..: :||:..|.:..|.: .|..|     ...:.|.|:      :|.
  Fly    65 YGV-DKLSE--MDRSQLDKKA-RLLRHRDCIGRPVIYIPAKN-----HSSERDIDELTRFIVYNL 120

  Fly   119 TAAIKVFFMVADCRFATENEERLSDGEIPVFDMAGYTLR----HLTKTALGALRVYMKFVQEAHP 179
            ..|.|..|            |.::|....|||:|.::..    .|.:..:..|..:.       |
  Fly   121 EEACKKCF------------EEVTDRLCIVFDLAEFSTSCMDYQLVQNLIWLLGKHF-------P 166

  Fly   180 VRLKEIHVLNCPSYVDKVMAVVKPFIKGEVFKLIHFHLPNAD 221
            .||....::|.|.....:...::..:.....|.:.|....|:
  Fly   167 ERLGVCLIINSPGLFSTIWPAIRVLLDDNTAKKVKFVADEAE 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:238099 25/143 (17%)
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 27/148 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447113
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.