DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and CG13893

DIOPT Version :10

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster


Alignment Length:53 Identity:14/53 - (26%)
Similarity:23/53 - (43%) Gaps:13/53 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 EVYAWTSTLLPAVAGASIFKVLSMIPIWIWLLSNLTDWEYGLANFLYNNILNA 249
            ::|.||..      |:|:|:|......|       .|.:..|.:|..|::|.|
  Fly   209 DLYCWTRN------GSSLFRVWRDTAFW-------EDMKPALFDFWQNHVLPA 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:469559 9/41 (22%)
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024
CRAL_TRIO 81..245 CDD:459890 12/48 (25%)
GPCR_chapero_1 303..381 CDD:480652
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.