DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and Sec14l3

DIOPT Version :9

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001025108.1 Gene:Sec14l3 / 380683 MGIID:3617848 Length:401 Species:Mus musculus


Alignment Length:347 Identity:70/347 - (20%)
Similarity:119/347 - (34%) Gaps:92/347 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LNEKAEDQLMTTRISDLQDWLQAQPQLPQNISRLLLRRFLHTTRGDLSAAQRLLELNYGLRNKHA 68
            |:.|..:.|...| .::||.|.|.|    |.....|.|:|.....||..::.:|......|..  
Mouse     8 LSPKQAETLAKFR-ENVQDVLPALP----NPDDYFLLRWLRARNFDLQKSEAMLRKYMEFRKT-- 65

  Fly    69 HIFIDRDP-LDASSQQLLQVADLVPLPG----------------LTPENNKLLFYRLIDFDADKF 116
               :|.|. ||....:::|..    :||                :.|.:.|.|.:.:...|..|.
Mouse    66 ---MDIDHILDWQPPEVIQKY----MPGGLCGYDRDGCPVWYDIIGPLDPKGLLFSVTKQDLLKT 123

  Fly   117 NFTAAIKVFFMVADCRFATENEERLSDGEIPVFDMAGYTLRHLTKTALGALRVYMKFVQEAHPVR 181
            ......::   :.:|...||...|..:..:.:||..|..|:|..|..:...:.:...::|.:|..
Mouse   124 KMRDCERI---LHECDLQTERLGRKIETIVMIFDCEGLGLKHFWKPLVEVYQEFFGLLEENYPET 185

  Fly   182 LKEIHVLNCPSYVDKVMAVVKPFI----------------KGEVFKLIH-FHLPNADTPYRHF-- 227
            ||.:.::...........::|||:                |..:.|||. ..||      .||  
Mouse   186 LKFMLIVKATKLFPVGYNLMKPFLSEDTRRKIVVLGSNSWKEGLLKLISPEELP------AHFGG 244

  Fly   228 --------PRSMLPEEYGGEAGK----MSDLKLQWMQLLKEQRDYLMDTE----------NWQIN 270
                    |:.:....||||..|    ...:|.|:...::..|......|          .||.:
Mouse   245 TLTDPDGNPKCLTKINYGGEIPKSMYVRDQVKTQYEHSVQISRGSSHQVEYEILFPGCVLRWQFS 309

  Fly   271 K----------IK-KNGQRKSS 281
            .          :| |.|:|:.:
Mouse   310 SDGADIGFGVFLKTKMGERQKA 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:238099 35/191 (18%)
Sec14l3NP_001025108.1 CRAL_TRIO_N 13..59 CDD:215024 14/50 (28%)
SEC14 76..246 CDD:214706 33/182 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.