DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and Sec14l1

DIOPT Version :9

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001101779.1 Gene:Sec14l1 / 360668 RGDID:1563123 Length:720 Species:Rattus norvegicus


Alignment Length:253 Identity:55/253 - (21%)
Similarity:97/253 - (38%) Gaps:45/253 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LQDWLQA--QPQLPQNISRLLLRRFLHTTRGDLSAAQRLLELNYGLRNKHAHIFIDRDPLDA-SS 81
            |:.|||.  :.::|::...|   |||.....::..|:.::..:...|.:|...:|    ||. :.
  Rat   263 LRQWLQETHKGKIPKDEHIL---RFLRARDFNIDKAREIMCQSLTWRKQHQVDYI----LDTWTP 320

  Fly    82 QQLLQVADLVPLPGLTPENNKLLFYRLIDFDADKFNFTAAIKVFFMVADCRFATE-NEE--RLSD 143
            .|:||............:...|...||...|.     ...::.....|..|:... |||  |..:
  Rat   321 PQVLQDYYAGGWHHHDKDGRPLYVLRLGQMDT-----KGLVRALGEEALLRYVLSINEEGLRRCE 380

  Fly   144 GEIPVF-----------DMAGYTLRHLTKTALGALRVYMKFVQEAHPVRLKEIHVLNCPSYVDKV 197
            ....||           |:.|..:|||.:..:.||...::.|:..:|..|..:.:|..|.....:
  Rat   381 ENTKVFGRPISSWTCLVDLEGLNMRHLWRPGVKALLRIIEVVEANYPETLGRLLILRAPRVFPVL 445

  Fly   198 MAVVKPFIKGEVFK--LIHFHLPNADTPYR-------HFPRSMLPEEYGGEAGKMSDL 246
            ..:|.|||.....:  ||:     |...|:       :..:.::|:...||.  |.|:
  Rat   446 WTLVSPFIDDNTRRKFLIY-----AGNDYQGPGGLLDYIDKEIIPDFLSGEC--MCDV 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:238099 33/171 (19%)
Sec14l1NP_001101779.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 257..302 CDD:215024 10/41 (24%)
CRAL_TRIO 327..491 CDD:279044 33/173 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.