DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and CG12926

DIOPT Version :9

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster


Alignment Length:304 Identity:75/304 - (24%)
Similarity:138/304 - (45%) Gaps:18/304 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LNEKAEDQL--MTTRISD----LQDWLQAQPQLPQNISRLLLRRFLHTTRGDLSAAQRLLELNYG 62
            |.:||.|:|  :..||.:    |:.|:..||.|........|..||...:..|...:..|:..|.
  Fly    16 LAKKAHDELGEIPDRIDEDIETLRTWISKQPHLKARQDAQFLVAFLRGCKYSLEKTKLKLDNFYA 80

  Fly    63 LRNKHAHIFIDRDPLDASSQQLLQVAD---LVPLP-GLTPENNKLLFYRLIDFDADKFNFTAAIK 123
            :|.....::.:|    ...::.|.:.|   |:.|| .|..:..::...|...:|:.|::....::
  Fly    81 MRGAVPELYKNR----IVGEKQLSILDTGCLLRLPQPLQADGPRIHISRYGQYDSKKYSIAEVVQ 141

  Fly   124 VFFMVADCRFATENEERLSDGEIPVFDMAGYTLRHLTKTALGALRVYMKFVQEAHPVRLKEIHVL 188
            |..|:.:.:. .|::..:..|.:.:.||.|....||.:.....::.......:|:|.|.|..|.:
  Fly   142 VNTMLGEIQI-REDDNAMISGFVEIIDMKGVGAGHLFQFDAVLVKKLAVLGDKAYPYRPKGFHFV 205

  Fly   189 NCPSYVDKVMAVVKPFIKGEVFKLIHFHLPNADTPYRHFPRSMLPEEYGGEAGKMSDLKLQWMQL 253
            |.||..:|.|::.|..:..::.|..|.| ...|:.|::.|:..||.||||..|.:.|:...|...
  Fly   206 NAPSSAEKFMSIAKSLMSEKIRKRFHIH-SKLDSLYKYVPKECLPAEYGGSNGTIQDVVSTWRTK 269

  Fly   254 LKEQRDYLMDTENWQINKIKKNGQRKSSDS--GVTEGLRSLEID 295
            |...:.:..:..::..|:..:.||..|::|  |:....|.|:||
  Fly   270 LLAYKPFFEEEASYGTNEKLRRGQPVSAESLFGIEGSFRKLDID 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:238099 38/149 (26%)
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 10/44 (23%)
SEC14 117..254 CDD:238099 33/138 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447105
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.