DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and CG1902

DIOPT Version :9

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_610507.1 Gene:CG1902 / 35993 FlyBaseID:FBgn0033434 Length:312 Species:Drosophila melanogaster


Alignment Length:292 Identity:58/292 - (19%)
Similarity:114/292 - (39%) Gaps:20/292 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LNEKAEDQL------MTTRISDLQDWLQAQPQLPQNISRLLLRRFLHTTRGDLSAAQRLLELNYG 62
            |.|.|..||      ...:|..|:.|:..|..|........|..||...|.|:..|::.:...|.
  Fly    11 LAEVARTQLCEDPSSTVAKIEALRTWIDKQIYLEARTDDQFLVAFLRFCRWDVEEAKKRVLFYYT 75

  Fly    63 LRNKHAHIFIDRDPLDASSQQLLQVA-----DLVPLPGLTPENNKLLFYRLIDFDADKFNFTAAI 122
            .::|...:...|...|    :|:::|     ..:|.| :.|...::.:.|:...:..|.:.:...
  Fly    76 YKSKERELLKGRQVDD----KLIELARSGIFATLPKP-IGPGGPRIHYTRMGHIEPSKHSVSDIF 135

  Fly   123 KVFFMVADCRFATENEERLSDGEIPVFDMAGYTLRHLTKTALGALRVYMKFVQEAHPVRLKEIHV 187
            :.....|:....|::...:: |.:.:.|........|.:...|..:....|::...|..|...|:
  Fly   136 RFHAFRAEIEINTDDNWNIA-GVVEIIDFTKIPYSLLLQFDPGMFKRMNAFLEHGIPANLVATHI 199

  Fly   188 LNCPSYVDKVMAVVKPFIKGEVFKLIHFHLPNADTPYRHFPRSMLPEEYGGEAGKMSDLKLQWMQ 252
            :|.......|:.:|:..:|.:  :|:|.|...|.. .:......||.|.||:.|.:||...::..
  Fly   200 VNASRETQFVLGLVRNVMKQK--ELLHIHSTVASL-RKAIGLEYLPVEMGGDNGSLSDAMTRYET 261

  Fly   253 LLKEQRDYLMDTENWQINKIKKNGQRKSSDSG 284
            .|.....|..:.|.:.:::..:....|..:.|
  Fly   262 QLLSFSPYFTEDERYGVDEKLREASEKDQERG 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:238099 27/148 (18%)
CG1902NP_610507.1 CRAL_TRIO_N 28..69 CDD:215024 11/40 (28%)
CRAL_TRIO 100..248 CDD:279044 27/152 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447104
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.