DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and CG10026

DIOPT Version :9

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster


Alignment Length:239 Identity:48/239 - (20%)
Similarity:91/239 - (38%) Gaps:30/239 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PQNISRLLLRRFLHTTRGDLSAAQRLLELNYGLRNKHAHIFIDRDPLD---ASSQQLLQVADLVP 92
            |.......|.:||......:..:.:||...|..|.::...:....|||   .....:|.|.    
  Fly    61 PHRSDAKYLEKFLRARYWKIENSYKLLCSYYRFREQNKSFYEKVRPLDLRHVGQSDILTVT---- 121

  Fly    93 LPGLTPENNKLLFYRL-------IDFDADKFNFTAAIKVFFMVADCRFATENEERLSD--GEIPV 148
             |......:::|.||.       :..| |.|..|..::....:          |.:|.  |.:.:
  Fly   122 -PYRDQHGHRILIYRFGLWRPNQVTVD-DIFRATIVLQELGSL----------EPISQIVGGVGI 174

  Fly   149 FDMAGYTLRHLTKTALGALRVYMKFVQEAHPVRLKEIHVLNCPSYVDKVMAVVKPFIKGEVFKLI 213
            ||:....|.|:...:....:..:..:..:.|:|...:|::|.....:....:.|||:...:.:.:
  Fly   175 FDLKDLGLEHILHLSPSVAQKMIALLVTSMPIRTSALHIVNQNWVFNAAFKIFKPFLNAAMREKL 239

  Fly   214 HFHLPNADTPYRHFPRSMLPEEYGGEAGKMSDLKLQWMQLLKEQ 257
            :.|..:..:.::|.....||:.|||.....|  ...|:.:||||
  Fly   240 YIHGSDMTSLHKHINPEHLPKRYGGLHEDYS--YTLWLDMLKEQ 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:238099 28/157 (18%)
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 6/28 (21%)
SEC14 112..265 CDD:238099 30/168 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.