DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and CG10237

DIOPT Version :9

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_609967.1 Gene:CG10237 / 35222 FlyBaseID:FBgn0032783 Length:324 Species:Drosophila melanogaster


Alignment Length:317 Identity:75/317 - (23%)
Similarity:132/317 - (41%) Gaps:69/317 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DQLMTTRISD---------------------LQDWLQAQPQLPQNISRLL--------------- 38
            |||.|.::.|                     |::..:.|.:..:.::|||               
  Fly    29 DQLPTLQVGDYTLQFELGEPTAQGKEVAIKELRETPERQKEASKELARLLEAETDLLYPKGNEEW 93

  Fly    39 LRRFLHTTRGDLSAAQRLLELNYGLRNKHAHIFIDRDPLDASSQQLLQVADLVPLPGLTPENNKL 103
            |.|:|...:....:|:.|::..|..:.|||.::.|..|.:.::.....:..:.|       |...
  Fly    94 LIRYLRPCKYYPESARDLIKRYYAFKVKHADVYTDLKPSNEANIFKHNILTVFP-------NRDQ 151

  Fly   104 LFYRLIDFDADK------FNFTAAIK--VFFMVADCRFATENEERLSDGEIPVFDMAGYTLRHLT 160
            |..|::..:..|      .......|  |.|:.|    |....|....|.:.:|||.|.:|:...
  Fly   152 LGRRILVLELGKRWKHKQVTLDEVFKGAVLFLEA----AMLEPETQICGAVVIFDMDGLSLQQTW 212

  Fly   161 KTALGALRVYMKFVQEAHPVRLKEIHVLNCPSYVDKVMAVVKPFIKGEVFKLIHFHLPNADTPYR 225
            :......:..:.::|::.|:|:|.||::|.|.....|.|:.|||:|.::...|.||..:.::.::
  Fly   213 QFTPPFAKRIVDWLQDSVPLRIKAIHIVNQPKIFQVVFALFKPFLKEKLRSRIIFHGTDRESLHK 277

  Fly   226 HFPRSMLPEEYGG--EAGKM-SDLKLQWMQLLKEQRDYLMDTENWQINKIKKNGQRK 279
            :.....||..|||  ||.:: ||   ||.|||.:     .|||   .:.|...|.:|
  Fly   278 YMSPKCLPAAYGGFREASRIDSD---QWYQLLLK-----CDTE---FDTINSYGYKK 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:238099 39/158 (25%)
CG10237NP_609967.1 CRAL_TRIO_N 68..115 CDD:215024 8/46 (17%)
SEC14 137..290 CDD:238099 37/163 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447116
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.