DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and CG5958

DIOPT Version :9

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster


Alignment Length:274 Identity:59/274 - (21%)
Similarity:111/274 - (40%) Gaps:23/274 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VHLNEKAEDQLMTTRISDLQDWLQAQPQLPQNISRLLLRRFLHTTRGDLSAAQRLLELNYGLRNK 66
            |.|.|  .:::....|..|::.|:|.|:|........|..||.........|...::.....|.:
  Fly    28 VELRE--TEEVKAEAIIKLRELLKATPELNYKDDDAFLTVFLRACHFYPEGALEKMKTTASFRKE 90

  Fly    67 HAHIF-------IDRDPLDASSQQLLQVADLVPLPGLTPENNKLLFYRLIDFDADKFNFTAAIKV 124
            :|.:.       :....:..|...:|:..|......|.....||       :|..........::
  Fly    91 YASLVRGLLVEQVKEKFVKGSVINVLKNCDQKGRRVLIVNCGKL-------WDPSDITSDEMFRM 148

  Fly   125 FFMVADCRFATENEERLS-DGEIPVFDMAGYTLRHLTKTALGALRVYMKFVQEAHPVRLKEIHVL 188
            .:||   ..|.:.||... .|.:.:.|..|.:::.:...:....:..:.|:|||.|:|:||:|.:
  Fly   149 LYMV---HLAAQLEEETQVRGVVCIMDFEGLSMKQVKALSPSFSKRLLTFIQEAMPLRMKEVHFV 210

  Fly   189 NCPSYVDKVMAVVKPFIKGEVFKLIHFHLPNADTPYRHFPRSMLPEEYGGEAGKMSDLKLQWMQL 253
            ..|...:.|.::.|||:|.::...:|||..:..:..:....|:||..|.|....:....::|...
  Fly   211 KQPFIFNMVWSLFKPFVKQKLNNRMHFHGSDMKSLQKFLDPSVLPANYKGTLPAIDYGGVEWFPA 275

  Fly   254 LKEQRDYLMDTENW 267
            |::|..|:   |.|
  Fly   276 LEQQAQYV---EEW 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:238099 34/149 (23%)
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 10/43 (23%)
CRAL_TRIO 111..261 CDD:279044 37/159 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053004at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.