DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and retm

DIOPT Version :9

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster


Alignment Length:267 Identity:61/267 - (22%)
Similarity:98/267 - (36%) Gaps:49/267 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LNEKAEDQLMTTR-ISDLQDWLQAQPQLPQNISRLLLRRFLHTTRGDLSAAQRLLELNYGLRNKH 67
            |:...|.:|:..| :.|..|.|:..|.. |.|.|.|..|..|     :|.|..:|..:...|.:|
  Fly   217 LSPMQESKLLELRKMLDGVDDLERVPSY-QTILRFLAARDWH-----VSQAYAMLCDSLRWRREH 275

  Fly    68 AHIFIDRDPLDASSQQLLQVADLVP-LPG----LTPENNKLLFYRLIDFDADKFNFTAAIKVFFM 127
            .        :||...:..:.|.:|. .||    |..:...:...||...|.     ...:|...|
  Fly   276 R--------IDALLAEYSKPAVVVEHFPGGWHHLDKDGRPVYILRLGHMDV-----KGLLKSLGM 327

  Fly   128 VADCRFA-----------TENEERLSDGEIPVF------DMAGYTLRHLTKTALGALRVYMKFVQ 175
            ....|.|           .|:.|||   |.||.      |:.|.::|||.:..:.||...::.|:
  Fly   328 DGLLRLALHICEEGIQKINESAERL---EKPVLNWSLLVDLEGLSMRHLWRPGIKALLNIIETVE 389

  Fly   176 EAHPVRLKEIHVLNCPSYVDKVMAVVKPFIKGEVFKLIHFHLPNA----DTPYRHFPRSMLPEEY 236
            ..:|..:..:.|:..|........:|..||.........|:.|:.    |...::....::|:..
  Fly   390 RNYPETMGRVLVVRAPRVFPIAWTIVSAFIDEHTRSKFLFYGPDCAHMKDGLAQYLDEEIVPDFL 454

  Fly   237 GGEAGKM 243
            ||....|
  Fly   455 GGPCKTM 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:238099 37/174 (21%)
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024 16/51 (31%)
CRAL_TRIO 293..456 CDD:279044 35/170 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.