DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and CG31826

DIOPT Version :9

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster


Alignment Length:288 Identity:61/288 - (21%)
Similarity:103/288 - (35%) Gaps:71/288 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 MTTRISDLQDWLQAQPQLPQNISR----------LLLRRFLHTTRGDLSAAQRLLELNYGLRNKH 67
            :|.|:....:.:....||.|.:.:          .||.:|||.||.|...|.:.:...|..:.:|
  Fly     4 LTARVDHTAEQIFKIEQLRQLVEKCEDLRVGTEDTLLTKFLHYTRWDTIKAYQAIHDYYEFKRRH 68

  Fly    68 AHIFIDRDPLDASSQQLLQVADLVPLPGLTPENNKLLFY----RLIDFDADKFNFTAAIKVFFMV 128
            . .::.|.|:                     |:.:.|||    |.:...||:   :..:.|.|..
  Fly    69 P-TWVARHPI---------------------EHYRQLFYGTHCRYVMPQADR---SGRVLVVFKT 108

  Fly   129 AD--------CRFATENEERLSDG--EIPVFDMAGYT-LRHLTKTALGALR----VYMKFVQEAH 178
            .|        .:...|.::.:.:.  .:|.....|.| :..|..|....||    .:||.|.|.:
  Fly   109 VDGFQDYPDYLQSLVEMDDLIFESLLLLPRVQQNGITVICDLQGTNRNFLRQFSPAFMKVVNEKN 173

  Fly   179 ---PVRLKEIHVLNCPSYVDKVMAVVKPFIKGEVFKLIHFHLPNADTPYRHFPR-------SMLP 233
               |...:.:|::.....:.....:..||:..|..:.|..|      ..||..:       ..||
  Fly   174 GVLPFSQRIVHIIQRGFLMHVTSTLFMPFMNKEFKEKIFTH------DGRHLSKLREMVGYESLP 232

  Fly   234 EEYGGEAGKMSDLKLQWMQLLKEQRDYL 261
            .||||.|..:.|..|.:.. |.:..:||
  Fly   233 AEYGGPATNVLDTNLIFNH-LSQNAEYL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:238099 36/177 (20%)
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 12/43 (28%)
CRAL_TRIO 92..237 CDD:279044 30/153 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.