DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and ttpa

DIOPT Version :9

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_956025.2 Gene:ttpa / 325906 ZFINID:ZDB-GENE-030131-4631 Length:285 Species:Danio rerio


Alignment Length:280 Identity:62/280 - (22%)
Similarity:119/280 - (42%) Gaps:62/280 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LNEKAEDQLMTTRISDLQDWLQAQPQLPQNISRLLLRRFLHTTRGDLSAAQRLLELNYG------ 62
            |.||||.:|   ||.||            ::|:..|.|||.....|::.|.:|| :||.      
Zfish    29 LKEKAEAEL---RIRDL------------DLSKTFLIRFLQARDFDVALALKLL-INYHKWRQEC 77

  Fly    63 ---------------LRNKHAHIFIDRDPLDASSQQLLQVADLVPLPGLTPENNKLLFYRLIDFD 112
                           |:|.:..:...||  ||.|                    ::|.||:..::
Zfish    78 PEITADLRPSSVIGLLQNNYHGVLRSRD--DAGS--------------------RVLIYRIGKWN 120

  Fly   113 ADKFNFTAAIKVFFMVADCRFATENEERLSDGEIPVFDMAGYTLRHLTKTALGALRVYMKFVQEA 177
            ..:|......:|..:.::  ...:..|...:|...:||:..:...|..:......:.....:.::
Zfish   121 PKEFTAYEVFRVSLITSE--LIVQEWETQRNGLKAIFDLQDWCFAHALQINPSLAKKISSVLTDS 183

  Fly   178 HPVRLKEIHVLNCPSYVDKVMAVVKPFIKGEVFKLIHFH-LPNADTPYRHFPRSMLPEEYGGEAG 241
            .|::::.||::|.|.:...|.|:::||:..::.:.||.| ...|.:...:||:::||..|||...
Zfish   184 FPLKVRGIHLINEPIFFRPVFAMIRPFLPDKIKQRIHMHGCSYARSLCNYFPKAVLPPVYGGTGP 248

  Fly   242 KMSDLKLQWMQLLKEQRDYL 261
            .:.::..:|.:.:.:..|||
Zfish   249 SVDEVCQEWTEYIMQSEDYL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:238099 29/149 (19%)
ttpaNP_956025.2 CRAL_TRIO_N 26..70 CDD:215024 19/56 (34%)
CRAL_TRIO 97..246 CDD:279044 34/172 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053004at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.