DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and CG3191

DIOPT Version :9

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster


Alignment Length:265 Identity:124/265 - (46%)
Similarity:180/265 - (67%) Gaps:4/265 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ISDLQDWLQAQPQLPQNISRLLLRRFLHTTRGDLSAAQRLLELNYGLRNKHAHIFIDRDPLDASS 81
            :.:|.:|.:...:||:.|..||||||.....||:...::|:|:||.|||:|.|:||.||||||.|
  Fly    38 LKELLEWFRQNDKLPKEIDPLLLRRFYQCMFGDVEETRKLIEVNYALRNRHPHLFIKRDPLDADS 102

  Fly    82 QQLLQVADLVPLPGLTPENNKLLFYRLIDFDADKFNFTAAIKVFFMVADCRFATENE----ERLS 142
            ::....||::|||||||:..|:..|...:|:|.|.:.|...:.||||:||||.|.::    :.||
  Fly   103 KRTFDYADILPLPGLTPDKCKVSLYCFREFEASKMHHTEDTRAFFMVSDCRFVTPDDLAKPDVLS 167

  Fly   143 DGEIPVFDMAGYTLRHLTKTALGALRVYMKFVQEAHPVRLKEIHVLNCPSYVDKVMAVVKPFIKG 207
            :||:.:|||.|.|:||:::..:..||.|:||:|.|.||||:.||::|||:|:|::::||||||..
  Fly   168 EGEVQIFDMKGTTMRHISRLTISTLRAYIKFLQLAFPVRLRAIHMINCPTYLDRIVSVVKPFISD 232

  Fly   208 EVFKLIHFHLPNADTPYRHFPRSMLPEEYGGEAGKMSDLKLQWMQLLKEQRDYLMDTENWQINKI 272
            ||||||.||..:.:|.|...||.||||||||.||.:..|:....:.|.|.||||||.::|.:.|.
  Fly   233 EVFKLIRFHTQSINTLYEFVPREMLPEEYGGGAGSLEALRTHTQKALVEHRDYLMDPDHWVVVKP 297

  Fly   273 KKNGQ 277
            :|..:
  Fly   298 EKRNE 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:238099 76/152 (50%)
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 74/148 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469479
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26017
OrthoDB 1 1.010 - - D1053004at2759
OrthoFinder 1 1.000 - - FOG0009968
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.