DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and Ttpa

DIOPT Version :9

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_037180.1 Gene:Ttpa / 25571 RGDID:3915 Length:278 Species:Rattus norvegicus


Alignment Length:268 Identity:68/268 - (25%)
Similarity:123/268 - (45%) Gaps:21/268 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LNEKAE-DQLMTTRISDLQDWLQAQ--PQLPQNISRLLLRRFLHTTRGDLSAAQRLLELNYGLRN 65
            |||:.: ..|:...:::|:...|.:  |:.||.::...|.|||.....||..|.||::..|..|.
  Rat    14 LNEQPDHSPLVQPGLAELRRRAQEEGVPETPQPLTDAFLLRFLRARDFDLDLAWRLMKNYYKWRA 78

  Fly    66 KHAHIFIDRDP------LDASSQQLLQVADLVPLPGLTPENNKLLFYRLIDFDADKFNFTAAIKV 124
            :...:..|..|      |.|....:|:..|        |..:::|.||:..:|...|......:|
  Rat    79 ECPELSADLHPRSILGLLKAGYHGVLRSRD--------PTGSRVLIYRISYWDPKVFTAYDVFRV 135

  Fly   125 FFMVADCRFATENEERLSDGEIPVFDMAGYTLRHLTKTALGALRVYMKFVQEAHPVRLKEIHVLN 189
            ..:.::  ...:..|...:|...:||:.|:.:.|..:......:.....|.::.|::::.||::|
  Rat   136 SLITSE--LIVQEVETQRNGVKAIFDLEGWQISHAFQITPSVAKKIAAVVTDSFPLKVRGIHLIN 198

  Fly   190 CPSYVDKVMAVVKPFIKGEVFKLIHFHLPN-ADTPYRHFPRSMLPEEYGGEAGKMSDLKLQWMQL 253
            .|.....|.:::|||:..::...||.|..| ..:..:||| .:||.||||....|.|:..:|...
  Rat   199 EPVIFHAVFSMIKPFLTEKIKGRIHLHGNNYKSSLLQHFP-DILPLEYGGNESSMEDICQEWTNF 262

  Fly   254 LKEQRDYL 261
            :.:..|||
  Rat   263 IMKSEDYL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:238099 35/149 (23%)
TtpaNP_037180.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 3/7 (43%)
CRAL_TRIO_N 25..73 CDD:215024 14/47 (30%)
CRAL_TRIO 99..248 CDD:395525 37/159 (23%)
Phosphatidylinositol 3,4-bisphosphate binding. /evidence=ECO:0000250|UniProtKB:Q8BWP5 190..192 0/1 (0%)
Phosphatidylinositol 4,5-bisphosphate binding. /evidence=ECO:0000250|UniProtKB:Q8BWP5 208..211 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053004at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.