DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and CG30339

DIOPT Version :9

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster


Alignment Length:297 Identity:72/297 - (24%)
Similarity:131/297 - (44%) Gaps:12/297 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LNEKAEDQLMTTRISDLQDWLQAQPQLPQNISRLLLRRFLHTTRGDLSAAQRLLELNYGLRNKHA 68
            |||  .::.:...:..|:|||..||.|........|..||...:..|...:..|:..|.::....
  Fly    19 LNE--VEERVPADLKALRDWLAKQPHLRARQDDQFLVGFLRGCKFSLEKTKSKLDHFYTIKTLMP 81

  Fly    69 HIFIDRDPLDASSQQLLQVADLVPLP---GLTPENNKLLFYRLIDFDADKFNFTAAIKVFFMVAD 130
            .:|..| .:|..:..|.:....|.||   |......:|..|.  .||..:|......:...|:.:
  Fly    82 ELFGKR-LVDERNLILCRSGTYVRLPKPWGTDGPRLQLTNYE--KFDPKEFKLLDLFRYQTMITE 143

  Fly   131 CRFATENEERLSDGEIPVFDMAGYTLRHLTKTALGALRVYMKFVQEAHPVRLKEIHVLNCPSYVD 195
            .....::...:| |.:.:.|||..:|..|.:.....::....|.::|.|.|||.:|::|||....
  Fly   144 QSIREDDHSNIS-GYVEIVDMAKMSLSFLAQLDFTLIKRMGIFAEKAQPTRLKGVHLINCPKEGV 207

  Fly   196 KVMAVVKPFIKGEVFKLIHFHLPNADTPYRHFPRSMLPEEYGGEAGKMSDLKLQWMQLLKEQRDY 260
            .::.:.|..:..::.:..|.: .|.:......||..|||||||..|:::|::.:..:.|.....|
  Fly   208 ALLNLAKSLMPSKLQQRFHVY-KNLEQLNEVIPREYLPEEYGGNNGRIADIQAEAEKKLLSYESY 271

  Fly   261 LMDTENWQINKIKKNGQRKSSDS--GVTEGLRSLEID 295
            ..:...:.:::..:.|:|.::||  |.....|.|:||
  Fly   272 FAEDSQYGVDEQLRPGKRVNADSIFGAEGSFRKLDID 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:238099 38/151 (25%)
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 11/41 (27%)
CRAL_TRIO 109..250 CDD:279044 35/144 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447106
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.