DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and SEC14L2

DIOPT Version :9

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_036561.1 Gene:SEC14L2 / 23541 HGNCID:10699 Length:403 Species:Homo sapiens


Alignment Length:256 Identity:60/256 - (23%)
Similarity:96/256 - (37%) Gaps:43/256 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 MTTRISDL---------------QDWLQAQPQLPQNISRLLLRRFLHTTRGDLSAAQRLLELNYG 62
            |:.|:.||               ||.|.|.|    |.....|.|:|.....||..::.:|..:..
Human     1 MSGRVGDLSPRQKEALAKFRENVQDVLPALP----NPDDYFLLRWLRARSFDLQKSEAMLRKHVE 61

  Fly    63 LR-NKHAHIFIDRDPLDASSQQL---LQVADLVPLPGLTPENNKLLFYRLI-DFDADKFNFTAAI 122
            .| .|.....|...|.:...|.|   :...||...|         ::|.:| ..||....|:|:.
Human    62 FRKQKDIDNIISWQPPEVIQQYLSGGMCGYDLDGCP---------VWYDIIGPLDAKGLLFSASK 117

  Fly   123 KVF---------FMVADCRFATENEERLSDGEIPVFDMAGYTLRHLTKTALGALRVYMKFVQEAH 178
            :..         .::.:|...|....|..:....::|..|..|:||.|.|:.|...::...:|.:
Human   118 QDLLRTKMRECELLLQECAHQTTKLGRKVETITIIYDCEGLGLKHLWKPAVEAYGEFLCMFEENY 182

  Fly   179 PVRLKEIHVLNCPSYVDKVMAVVKPFIKGEVFKLIHFHLPN-ADTPYRHFPRSMLPEEYGG 238
            |..||.:.|:..|........::|||:..:..|.|.....| .:...:|.....:|.||||
Human   183 PETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQVPVEYGG 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:238099 37/160 (23%)
SEC14L2NP_036561.1 CRAL_TRIO_N 13..59 CDD:215024 12/49 (24%)
SEC14 76..244 CDD:214706 41/177 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.