DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and Rlbp1

DIOPT Version :9

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001166954.1 Gene:Rlbp1 / 19771 MGIID:97930 Length:317 Species:Mus musculus


Alignment Length:261 Identity:58/261 - (22%)
Similarity:117/261 - (44%) Gaps:29/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HLNEKAEDQL---MTTR---ISDLQDWLQAQPQLPQNIS-----------RLLLRRFLHTTRGDL 50
            |..:||:|:|   ..||   :.:||:.:|||....:.::           ...|.||:...:.|:
Mouse    43 HTLQKAKDELNEKEETREEAVRELQELVQAQAASGEELALAVAERVQARDSAFLLRFIRARKFDV 107

  Fly    51 SAAQRLLELNYGLRNKHAHIFIDRDPLDASSQQLLQVADLVPLPGLTPENNK----LLFYRLIDF 111
            ..|..||:.....|.::..:|      |:.|.:.|:.......||:....:|    ::.:.:.::
Mouse   108 GRAYELLKGYVNFRLQYPELF------DSLSMEALRCTIEAGYPGVLSSRDKYGRVVMLFNIENW 166

  Fly   112 DADKFNFTAAIKVFFMVADCRFATENEERLSDGEIPVFDMAGYTLRHLTKTALGALRVYMKFVQE 176
            ..::..|...::.:..:.:  ...||||...:|...|.:..|:|::.........|:..:..:|:
Mouse   167 HCEEVTFDEILQAYCFILE--KLLENEETQINGFCIVENFKGFTMQQAAGLRPSDLKKMVDMLQD 229

  Fly   177 AHPVRLKEIHVLNCPSYVDKVMAVVKPFIKGEVFKLIHFHLPNADTPYRHFPRSMLPEEYGGEAG 241
            :.|.|.|.||.::.|.|......|||||:|.::.:.:..|..:.|..::....::||.::||...
Mouse   230 SFPARFKAIHFIHQPWYFTTTYNVVKPFLKNKLLQRVFVHGDDLDGFFQEIDENILPADFGGTLP 294

  Fly   242 K 242
            |
Mouse   295 K 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:238099 32/152 (21%)
Rlbp1NP_001166954.1 CRAL_TRIO_N 60..117 CDD:215024 12/56 (21%)
CRAL_TRIO 143..292 CDD:395525 32/150 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835986
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.