DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and cgr-1

DIOPT Version :10

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_508618.2 Gene:cgr-1 / 180650 WormBaseID:WBGene00020847 Length:383 Species:Caenorhabditis elegans


Alignment Length:46 Identity:11/46 - (23%)
Similarity:21/46 - (45%) Gaps:6/46 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 KQILAKKRISPDGDTMKSVRTLEGKH-ISMRPSQAEYFDALKDSWK 311
            |..:.||::   |..|:..|.:  .| |.:|......::|.:..|:
 Worm     5 KSFMIKKKL---GKKMRQNRPI--PHWIRLRTDNTIRYNAKRRHWR 45

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:469559
cgr-1NP_508618.2 SEC14 91..257 CDD:214706
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.