DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and C34C12.6

DIOPT Version :9

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_497717.2 Gene:C34C12.6 / 175452 WormBaseID:WBGene00007925 Length:400 Species:Caenorhabditis elegans


Alignment Length:257 Identity:48/257 - (18%)
Similarity:98/257 - (38%) Gaps:64/257 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QPQLPQNI-----SRLLLRRFLHTTRGDLSAAQRLLELNYG--LRNKHAHIFIDRDPLDASSQQL 84
            |.:||..|     :.|.|.|::....||   .::|:: |:.  |.::.|..|:..|    .:::.
 Worm    29 QEKLPDGIPDDVNTDLNLCRWIRGYHGD---TEKLVK-NFATYLASRKAAGFVGND----FAEKF 85

  Fly    85 LQVADLVPLPGLTP-----------------ENNKLLF--------------YRLIDFDADKFNF 118
            .:      ||.:.|                 |:|..||              ::..|:....|.:
 Worm    86 FE------LPSIAPFLQFIASSRLQDRQWSDEHNAFLFVERAWSQPKEFIKTFKTSDYLLHCFGY 144

  Fly   119 TAAIKVFFMVADCRFATENEERLSDGE---IPVFDMAGYTLRHLTKTALGALRVYM---KFVQEA 177
            :..::...:      ..|.::....|.   |.:||:....:........|.::::.   :..|:.
 Worm   145 SEMLQQLIL------RREKKQSADKGPVQFIVIFDLNTVNITDYVNPMSGYMKLWQIRSELWQDW 203

  Fly   178 HPVRLKEIHVLNCPSYVDKVMAVVKPFIKGEVFKLIHFHLPNADTPYRHFPRSMLPEEYGGE 239
            .|..::.|::.|.|..:..:..|.:.|:..|..|.|......:|...:..|..::|:|||||
 Worm   204 FPEMVQRIYLTNPPRLLGLLWKVARVFLSEENLKRIEIISDKSDLAGKFLPPWLVPKEYGGE 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:238099 31/185 (17%)
C34C12.6NP_497717.2 SEC14 91..265 CDD:214706 29/179 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.