DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and F18A11.2

DIOPT Version :9

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_496771.1 Gene:F18A11.2 / 174945 WormBaseID:WBGene00008929 Length:388 Species:Caenorhabditis elegans


Alignment Length:238 Identity:49/238 - (20%)
Similarity:88/238 - (36%) Gaps:33/238 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 WLQAQPQLPQNISRLLLRRFLHTTRGDLSAAQRLLELNYGLRNKHAHIFIDRDPLDASSQQLLQV 87
            ||.|.....:..::.|.|........||::.....||.....||:.       |:|...|.    
 Worm    35 WLVAYGNEEEEAAKALKRHLNIRKTIDLNSYSSKTELEEDELNKYV-------PIDVIGQN---- 88

  Fly    88 ADLVPLPGLTPENNKLLFYR---LIDFDA-------DKFNFTAAIKVFFMVADCRFATENEERLS 142
                     ..::||:|.:.   .||...       .|| ....:|:...|.....|.|.:....
 Worm    89 ---------HQDDNKVLMFERTGKIDISGLVDNVLMHKF-MQIKLKMMEGVHQKVVAAERKTGRQ 143

  Fly   143 DGEIPVFDMAGYTLR-HLTKTALGALRVYMKFVQEAHPVRLKEIHVLNCPSYVDKVMAVVKPFIK 206
            .|.:.:.|:.|.:.. .|.....|..|:....:.:.:|..|::|.::|.||:|:.:.....||:.
 Worm   144 SGGLFIMDLDGISFSPKLISVLTGPYRIMWGTLFDHYPQLLQKIIIVNAPSFVNVLHQACSPFLP 208

  Fly   207 GEV-FKLIHFHLPNADTPYRHFPRSMLPEEYGGEAGKMSDLKL 248
            .:. .|::....|......:|..:..||.:.||:..|.:.|.:
 Worm   209 EDYKEKIVITSEPAIGAIQKHADKCFLPSDLGGDLEKTTSLPM 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:238099 32/160 (20%)
F18A11.2NP_496771.1 SEC14 72..244 CDD:214706 38/192 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.