DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3823 and ctg-2

DIOPT Version :9

Sequence 1:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001254156.1 Gene:ctg-2 / 174360 WormBaseID:WBGene00011756 Length:408 Species:Caenorhabditis elegans


Alignment Length:242 Identity:46/242 - (19%)
Similarity:90/242 - (37%) Gaps:60/242 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 ELNYGLRNKHAHIFIDRDPLDASSQQLLQVADLVPLP---------GLTPENNKLLFYRLIDFDA 113
            ::.:.||..|| :.:|::.| ::.:::.|..|...:|         ||..|||.:....:...||
 Worm    68 KIKFSLRAIHA-LGLDQEDL-STLEKVAQKCDDCSVPLRYLPGSLIGLDHENNVVSLQMIGHLDA 130

  Fly   114 ----------DKFNFTAAIKVFFMVADCRFATENEERLSDGEIPVFDMAGYTLRHLTKTALGALR 168
                      |.:....|.....|....:...|..:.|  |...:||:.|.::..:...||..:.
 Worm   131 AGLMPATRNSDLYRMRIAESEGVMQIIRKMEKEQGKPL--GTSVIFDLDGLSMVQIDLAALKVVT 193

  Fly   169 VYMKFVQEAHPVRLKEIHVLNCPSYVDKVMAVVKPFIKGEVFKLIHFHLPNADTPYRHFPRSMLP 233
            ..:..:||..|..:::|.::|.|:::..:.:::.|.:..:..:                      
 Worm   194 TMLSQLQEMFPDVIRKIFIVNTPTFIQVLWSMISPCLAKQTQQ---------------------- 236

  Fly   234 EEYGGEAGKMSDLKLQWMQLLKEQRDYLMDTENWQINKIKKNGQRKS 280
                    |:..|...|.|.|||.....:..|.|       .|.||:
 Worm   237 --------KVKILGNDWKQHLKENIGEEVLFERW-------GGTRKA 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3823NP_572313.1 SEC14 90..239 CDD:238099 26/167 (16%)
ctg-2NP_001254156.1 SEC14 98..267 CDD:214706 36/207 (17%)
EMP24_GP25L 331..>405 CDD:279450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.